Myt1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Myt1 Antibody [NBP1-81021] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Myt1 Antibody [NBP1-81021] - Staining of human cerebellum shows moderate nuclear positivity in cells in granular layer.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myt1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEYSVIVEVRSDDDKDEDTHSRKSTVTDESEMQDMMTRGNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGLGEPGKAAKPLDT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IP reported in the scientific literature (PMID: 26607952).
Control Peptide
Myt1 Protein (NBP1-81021PEP)
Publications
Read Publications using
NBP1-81021 in the following applications:

  • IP
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%). Mouse reactivity reported in scientific literature (PMID: 26607952).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myt1 Antibody

  • C20orf36
  • KIAA0835
  • KIAA1050
  • MTF1
  • MTF1proteolipid protein binding protein
  • myelin transcription factor 1
  • Myelin transcription factor I
  • Myt1
  • MyTI
  • MYTIKIAA0835
  • PLPB1
  • PLPB1KIAA1050
  • Proteolipid protein-binding protein

Background

MYT1, also known as Myelin transcription factor 1, consists of a long 1,121 amino acid isoform that is 122 kDa, and is involved in the development of the central nervous system and the regulation of oligodendrocyte lineage development. Current research is being conducted on the relationship between MYT1 and a variety of diseases and disorders, including multiple sclerosis, papillary thyroid carcinoma, leukomalacia, neuronitis, sporadic breast cancer, skin cancer, pancreatitis, schizophrenia, thyroiditis, and carcinoma. The protein interacts with SIN3B, PIN1, PLK1, HDAC1, and CDK1, and has been linked to pancreatic and breast cancer pathways, as well as G1 to S cell cycle control.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Myt1 Antibody (NBP1-81021)(3)

Reviews for Myt1 Antibody (NBP1-81021) (0)

There are no reviews for Myt1 Antibody (NBP1-81021). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Myt1 Antibody (NBP1-81021) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myt1 Products

Research Areas for Myt1 Antibody (NBP1-81021)

Find related products by research area.

Blogs on Myt1

There are no specific blogs for Myt1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myt1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYT1
Entrez
Uniprot