Myt1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Myt1 Antibody [NBP1-81021] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Myt1 Antibody [NBP1-81021] - Staining of human cerebellum shows moderate nuclear positivity in cells in granular layer.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myt1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEYSVIVEVRSDDDKDEDTHSRKSTVTDESEMQDMMTRGNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGLGEPGKAAKPLDT
Specificity
Specificity of human, mouse Myt1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Myt1 Protein (NBP1-81021PEP)
Publications
Read Publications using
NBP1-81021 in the following applications:

  • IP
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%). Mouse reactivity reported in scientific literature (PMID: 26607952).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myt1 Antibody

  • C20orf36
  • MTF1proteolipid protein binding protein
  • myelin transcription factor 1
  • Myelin transcription factor I
  • MyT1
  • MyTI
  • MYTIKIAA0835
  • PLPB1KIAA1050
  • Proteolipid protein-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6000
Species: Hu, Mu
Applications: WB, Simple Western, IHC
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-02275
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-68757
Species: Hu
Applications: ICC/IF
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-74502
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3444
Species: Hu
Applications: WB
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P

Publications for Myt1 Antibody (NBP1-81021)(3)

Reviews for Myt1 Antibody (NBP1-81021) (0)

There are no reviews for Myt1 Antibody (NBP1-81021). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Myt1 Antibody (NBP1-81021) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Myt1 Antibody (NBP1-81021)

Discover related pathways, diseases and genes to Myt1 Antibody (NBP1-81021). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myt1 Antibody (NBP1-81021)

Discover more about diseases related to Myt1 Antibody (NBP1-81021).
 

Pathways for Myt1 Antibody (NBP1-81021)

View related products by pathway.

PTMs for Myt1 Antibody (NBP1-81021)

Learn more about PTMs related to Myt1 Antibody (NBP1-81021).
 

Research Areas for Myt1 Antibody (NBP1-81021)

Find related products by research area.

Blogs on Myt1

There are no specific blogs for Myt1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myt1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYT1