MYH6 Antibody (CL2155)

Images

 
Western Blot: MYH6 Antibody (CL2155) [NBP2-36745] - Analysis of human skeletal muscle tissue lysate.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MYH6 Antibody (CL2155) [NBP2-36745] - Staining in human heart muscle and liver tissues. Corresponding MYH6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MYH6 Antibody (CL2155) [NBP2-36745] - Staining of human heart muscle shows very strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: MYH6 Antibody (CL2155) [NBP2-36745] - Staining of human skeletal muscle shows strong cytoplasmic positivity in striated muscle fibers.
Immunohistochemistry-Paraffin: MYH6 Antibody (CL2155) [NBP2-36745] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL2155
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MYH6 Antibody (CL2155) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEA
Epitope
KLEQQVDDLEGSLEQ
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
MYH6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for MYH6 Antibody (CL2155)

  • alpha-MHC
  • ASD3
  • cardiomyopathy
  • CMD1EE
  • CMH14
  • Hypertrophic 1
  • MYH6
  • MYHC
  • MYHCA
  • MyHC-Alpha
  • Myosin Heavy Chain 6
  • Myosin Heavy Chain, Cardiac Muscle Alpha Isoform
  • Myosin, Heavy Chain 6, Cardiac Muscle, Alpha
  • Myosin, Heavy Polypeptide 6, Cardiac Muscle, Alpha (Cardiomyopathy, Hypertrophic 1)
  • Myosin-6
  • SSS3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-94079
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
AF2444
Species: Hu
Applications: IHC, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-94624
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85541
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-24585
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-05634
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP2-95223
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24916
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-36745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MYH6 Antibody (NBP2-36745) (0)

There are no publications for MYH6 Antibody (NBP2-36745).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYH6 Antibody (NBP2-36745) (0)

There are no reviews for MYH6 Antibody (NBP2-36745). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYH6 Antibody (NBP2-36745) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MYH6 Products

Array NBP2-36745

Bioinformatics Tool for MYH6 Antibody (NBP2-36745)

Discover related pathways, diseases and genes to MYH6 Antibody (NBP2-36745). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYH6 Antibody (NBP2-36745)

Discover more about diseases related to MYH6 Antibody (NBP2-36745).
 

Pathways for MYH6 Antibody (NBP2-36745)

View related products by pathway.

PTMs for MYH6 Antibody (NBP2-36745)

Learn more about PTMs related to MYH6 Antibody (NBP2-36745).

Blogs on MYH6

There are no specific blogs for MYH6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MYH6 Antibody (CL2155) and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH6
Uniprot