Musashi-1 Antibody (9S7Y1) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Musashi-1 (O43347). METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRA |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
MSI1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Musashi-1 Antibody (9S7Y1)
Background
Musashi1, a neural RNA-binding protein, plays an important role in regulating cell differentiation in precursor cells. Musashi-1 (Msi-1) has been shown to increase the accumulation of tau isoforms in intracellular inclusions in dementia. It may play a role in the pathogenesis of various neurodegenerative disorders. Musashi1 has also been detected in human tumor tissues such as gliomas and melanomas, suggesting its involvement in cancer development. Msi-1 also appears to play be an vital role in the development of several types of carcinoma such as human hepatoma, and may be a useful molecular marker for tumor detection.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB, ICC/IF
Publications for Musashi-1 Antibody (NBP3-16754) (0)
There are no publications for Musashi-1 Antibody (NBP3-16754).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Musashi-1 Antibody (NBP3-16754) (0)
There are no reviews for Musashi-1 Antibody (NBP3-16754).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Musashi-1 Antibody (NBP3-16754) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Musashi-1 Products
Research Areas for Musashi-1 Antibody (NBP3-16754)
Find related products by research area.
|
Blogs on Musashi-1