MTA2 Antibody - Azide and BSA Free Summary
| Description |
Novus Biologicals Knockout (KO) Validated Rabbit MTA2 Antibody - Azide and BSA Free (NBP2-93800) is a polyclonal antibody validated for use in WB and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human MTA2 (NP_004730.2). DSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MTA2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Chromatin Immunoprecipitation (ChIP) 1:50-1:200
- Knockout Validated
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for MTA2 Antibody - Azide and BSA Free
Background
Official Gene Symbol: MTA2 Gen Bank Accession Number: NP_004730 Gene ID: 9219 (Human) Gene Map Locus: 11q12-q13.1 (human) MTA2, a homologue of human MTA1 and MTA3, is a member of highly conserved MTA gene family. It is a component of NuRD, an ATP-dependent nucleosome remodeling and histone deacetylase complex. MTA2 is a nuclear protein that interacts with HDAC1 and HDAC2 and has a functional role in chromatin remodeling and deacetylase activity. MTA2 specifically interacts with p53 and represses p53-dependant transcriptional activation, thereby regulating p53-mediated cell growth arrest and apoptosis. It also inhibits the transcriptional activity of Estrogen receptor-alpha. Northern Blot analysis detected a ubiquitous expression of MTA2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for MTA2 Antibody (NBP2-93800) (0)
There are no publications for MTA2 Antibody (NBP2-93800).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MTA2 Antibody (NBP2-93800) (0)
There are no reviews for MTA2 Antibody (NBP2-93800).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MTA2 Antibody (NBP2-93800) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MTA2 Products
Research Areas for MTA2 Antibody (NBP2-93800)
Find related products by research area.
|
Blogs on MTA2