MPST Antibody

Images

 
Orthogonal Strategies: Western Blot: MPST Antibody [NBP1-82617] - Analysis in human cell lines HEK293 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunocytochemistry/ Immunofluorescence: MPST Antibody [NBP1-82617] - Staining of human cell line A-431 shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Simple Western: MPST Antibody [NBP1-82617] - Simple Western lane view shows a specific band for MPST in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of corresponding Simple Western lane view. MPST antibody was used at 1:20 dilution on Liver lysate(s).
Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of corresponding Simple Western lane view. MPST antibody was used at 1:20 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MPST Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPST
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:20
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID:27521839). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
MPST Protein (NBP1-82617PEP)
Publications
Read Publications using
NBP1-82617 in the following applications:

  • IHC
    1 publication
  • WB
    5 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23215842). Mouse reactivity reported in scientific literature (PMID: 27521839). Use in Rat reported in scientific literature (PMID:32215177).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MPST Antibody

  • mercaptopyruvate sulfurtransferase
  • MGC24539
  • MSThuman liver rhodanese
  • TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00027349-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
202-IL/CF
Species: Hu
Applications: BA
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-87148
Species: Hu
Applications: IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
NBP1-82865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-48017
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
H00001491-M01
Species: Gp, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
210-TA/CF
Species: Hu
Applications: BA
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-82617
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for MPST Antibody (NBP1-82617)(10)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(5)
All Applications
Filter By Species
Human
(2)
Mouse
(2)
Rat
(2)
All Species
Showing Publications 1 - 10 of 10.
Publications using NBP1-82617 Applications Species
Wells G, Glasgow JN, Nargan K et al. Mu CT Analysis of the Human Tuberculous Lung Reveals Remarkable Heterogeneity in 3D Granuloma Morphology American journal of respiratory and critical care medicine May 20 2021 [PMID: 34015247]
Mellis A, Misko A, Arjune S et al. The role of glutamate oxaloacetate transaminases in sulfite biosynthesis and H2S metabolism Redox Biology Jan 1 2020 [PMID: 33271457] (WB, Human) WB Human
Qinyu-Zeng , Shuhua-He , Fengzhi-Chen et al. Administration of H2S improves erectile dysfunction by inhibiting phenotypic modulation of corpus cavernosum smooth muscle in bilateral cavernous nerve injury rats Nitric Oxide Nov 24 2020 [PMID: 33246103] (WB, Rat) WB Rat
Jin Z, Zhang Q, Wondimu E et al. H2S stimulated bioenergetics in chicken erythrocytes and the underlying mechanism Am. J. Physiol. Regul. Integr. Comp. Physiol. May 20 2020 [PMID: 32432916]
Zhong L, Ding W, Zeng Q et Al. Sodium Tanshinone IIA Sulfonate Attenuates Erectile Dysfunction in Rats with Hyperlipidemia Oxid Med Cell Longev Mar 4 2020 [PMID: 32215177] (WB, Rat) WB Rat
Yetik-Anacak G, Dikmen A, Coletta C et al. Hydrogen sulfide compensates nitric oxide deficiency in murine corpus cavernosum. Pharmacol. Res. Aug 10 2016 [PMID: 27521839] (WB, Mouse) WB Mouse
Rashid S, Heer J, Garle M et al. Hydrogen sulphide-induced relaxation of porcine peripheral bronchioles. Br J Pharmacol 2013 Apr [PMID: 23215842]
Shibuya N, Mikami Y, Kimura Y et al. Vascular endothelium expresses 3-mercaptopyruvate sulfurtransferase and produces hydrogen sulfide. J Biochem 2009 Nov [PMID: 19605461]
Wells G, Glasgow J, Nargan K et al. 3D microarchitecture of the human tuberculous granuloma bioRxiv Jun 15 2020 (IHC, Human) IHC Human
Mitidieri E, Vanacore D, Turnaturi C et al. Uterine Dysfunction in Diabetic Mice: The Role of Hydrogen Sulfide Antioxidants (Basel, Switzerland) Sep 26 2020 [PMID: 32993056] (WB, Mouse) WB Mouse

Reviews for MPST Antibody (NBP1-82617) (0)

There are no reviews for MPST Antibody (NBP1-82617). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MPST Antibody (NBP1-82617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPST Products

Bioinformatics Tool for MPST Antibody (NBP1-82617)

Discover related pathways, diseases and genes to MPST Antibody (NBP1-82617). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPST Antibody (NBP1-82617)

Discover more about diseases related to MPST Antibody (NBP1-82617).
 

Pathways for MPST Antibody (NBP1-82617)

View related products by pathway.

Blogs on MPST

There are no specific blogs for MPST, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPST Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPST
Entrez
Uniprot