Orthogonal Strategies: Western Blot: MPST Antibody [NBP1-82617] - Analysis in human cell lines HEK293 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunocytochemistry/ Immunofluorescence: MPST Antibody [NBP1-82617] - Staining of human cell line A-431 shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: MPST Antibody [NBP1-82617] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Simple Western: MPST Antibody [NBP1-82617] - Simple Western lane view shows a specific band for MPST in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of corresponding Simple Western lane view. MPST antibody was used at 1:20 dilution on Liver lysate(s).
Simple Western: MPST Antibody [NBP1-82617] - Electropherogram image(s) of corresponding Simple Western lane view. MPST antibody was used at 1:20 dilution on RT-4 lysate(s).
Novus Biologicals Rabbit MPST Antibody - BSA Free (NBP1-82617) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-MPST Antibody: Cited in 13 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPST
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Tested in Liver, separated by Size, antibody dilution of 1:20, apparent MW was 39 kDa
Theoretical MW
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reactivity reported in scientific literature (PMID: 23215842). Mouse reactivity reported in scientific literature (PMID: 27521839). Use in Rat reported in scientific literature (PMID:32215177).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
MPST encodes a protein which can function as a monomer or as a disulfide-linked homodimer and which catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cyanide degradation and in thiosulfate biosynthesis. The encoded cytoplasmic protein is a member of the rhodanese family but is not rhodanese itself, which is a mitochondrial protein. Alternatively spliced transcript variants encoding the same protein have been identified.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our MPST Antibody - BSA Free and receive a gift card or discount.