MPST Antibody - BSA Free

Western Blot: MPST Antibody [NBP1-54734] - Lane 1 : 40 ug Human Liver lysate Lane 2: 40 ug Mouse Liver lysate Lane 3: 40 ug Rat Liver lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit Secondary Antibody conjugated with Alexa Fluor 647 Secondary, Antibody Dilution: 1 : 2500.

Western Blot: MPST Antibody [NBP1-54734] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MPST Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MPST(mercaptopyruvate sulfurtransferase) The peptide sequence was selected from the middle region of MPST. Peptide sequence DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPST
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MPST Antibody - BSA Free

• mercaptopyruvate sulfurtransferase
• MGC24539
• MSThuman liver rhodanese
• TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase

Background

MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.This gene encodes a protein which can function as a monomer or as a disulfide-linked homodimer and which catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cyanide degradation and in thiosulfate biosynthesis. The encoded cytoplasmic protein is a member of the rhodanese family but is not rhodanese itself, which is a mitochondrial protein. Alternatively spliced transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MPST Antibody (NBP1-54734)(2)

Publications using NBP1-54734

• Olivencia MA, Esposito E, Brancaleone V et al. Hydrogen sulfide regulates the redox state of soluble guanylate cyclase in CSE-/- mice corpus cavernosum microcirculation Pharmacological research 2023-06-20 [PMID: 37343646] (WB, Mouse)
• Panza E, De Cicco P, Armogida C et al. Role of the cystathionine gamma lyase/hydrogen sulfide pathway in human melanoma progression. Pigment Cell Melanoma Res 2015-01-01 [PMID: 25205294] (Human)

Bioinformatics

• Gene Symbol: MPST
• Entrez:
  • 4357(Human)
• Uniprot:
  • P25325(Human)