MPST Antibody

Images

 
Western Blot: MPST Antibody [H00004357-D01P] - Analysis of MPST expression in mouse testis.
Western Blot: MPST Antibody [H00004357-D01P] - Analysis of MPST expression in transfected 293T cell line by MPST polyclonal antibody.Lane 1: MPST transfected lysate(33.20 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MPST Antibody Summary

Immunogen
MPST (NP_066949.1, 1 a.a. - 297 a.a.) full-length human protein. MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPST
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MPST Antibody

  • mercaptopyruvate sulfurtransferase
  • MGC24539
  • MSThuman liver rhodanese
  • TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-87148
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
H00001491-M01
Species: Hu, GP
Applications: WB, ELISA
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for MPST Antibody (H00004357-D01P) (0)

There are no publications for MPST Antibody (H00004357-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPST Antibody (H00004357-D01P) (0)

There are no reviews for MPST Antibody (H00004357-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPST Antibody (H00004357-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPST Products

Bioinformatics Tool for MPST Antibody (H00004357-D01P)

Discover related pathways, diseases and genes to MPST Antibody (H00004357-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPST Antibody (H00004357-D01P)

Discover more about diseases related to MPST Antibody (H00004357-D01P).
 

Pathways for MPST Antibody (H00004357-D01P)

View related products by pathway.

Blogs on MPST

There are no specific blogs for MPST, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPST Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPST
Uniprot