MLLT1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MLLT1 Antibody [NBP1-84840] - Staining of human cell line U-251 MG shows localization to nucleoplasm & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: MLLT1 Antibody [NBP1-84840] - Staining of human hippocampus shows strong cytoplasmic and nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MLLT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLLT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MLLT1 Protein (NBP1-84840PEP)
Publications
Read Publication using
NBP1-84840 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%). Human reactivity reported in scientific literature (PMID: 26635203).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MLLT1 Antibody

  • ENLENL/MLL fusion
  • LTG19MLLT1/MLL fusion
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 1
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 1
  • protein ENL
  • YEATS domain-containing protein 1
  • YEATS1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocatedto, 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-248
Species: Hu
Applications: WB, IP
NB100-1566
Species: Hu
Applications: WB, IP
NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP2-45545
Species: Hu
Applications: WB, IHC
NB100-2628
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
AF7829
Species: Hu
Applications: WB, IHC, ICC
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
H00027125-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89222
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-16610
Species: Hu
Applications: WB
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MLLT1 Antibody (NBP1-84840)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MLLT1 Antibody (NBP1-84840) (0)

There are no reviews for MLLT1 Antibody (NBP1-84840). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MLLT1 Antibody (NBP1-84840) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MLLT1 Products

Bioinformatics Tool for MLLT1 Antibody (NBP1-84840)

Discover related pathways, diseases and genes to MLLT1 Antibody (NBP1-84840). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLLT1 Antibody (NBP1-84840)

Discover more about diseases related to MLLT1 Antibody (NBP1-84840).
 

Pathways for MLLT1 Antibody (NBP1-84840)

View related products by pathway.

PTMs for MLLT1 Antibody (NBP1-84840)

Learn more about PTMs related to MLLT1 Antibody (NBP1-84840).

Blogs on MLLT1

There are no specific blogs for MLLT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLLT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLLT1