MLLT1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MLLT1 Antibody [NBP1-84840] - Staining of human cell line U-251 MG shows localization to nucleoplasm & nucleoli fibrillar center.

Staining of human urinary bladder shows moderate positivity in urothelial cells.

Staining of human cerebellum shows strong nuclear and cytoplasmic positivity in Purkinje cells.

Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

Staining of human tonsil shows no nuclear positivity in non-germinal center cells as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MLLT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MLLT1 Antibody - BSA Free (NBP1-84840) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MLLT1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MLLT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 26635203). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MLLT1 Protein (NBP1-84840PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%). Human reactivity reported in scientific literature (PMID: 26635203).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MLLT1 Antibody - BSA Free

• ENLENL/MLL fusion
• LTG19MLLT1/MLL fusion
• myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 1
• myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 1
• protein ENL
• YEATS domain-containing protein 1
• YEATS1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocatedto, 1

Background

MLLT1, also known as ENL (eleven nineteen leukemia protein), was originally identified as a gene involved in a recurrent translocation (11;19) with the mixed-lineage leukemia (MLL) gene. The MLL-ENL fusion protein has been found to associate with SWI/SNF complexes and promote transcription from the HoxA7 promoter. Additionally, from studies to identify proteins that associate with MLLT1, MLLT1 is suggested to play a role in histone modification and transcriptional elongation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MLLT1 Antibody (NBP1-84840)(1)

Publication using NBP1-84840

• Elizabeth J. Perlman, Samantha Gadd, Stefan T. Arold et al. MLLT1 YEATS domain mutations in clinically distinctive Favourable Histology Wilms tumours. Nature Communications 2015-01-01 [PMID: 26635203] (WB, Human)

Bioinformatics

• Gene Symbol: MLLT1