AFF4 Antibody (2E12)

Images

 
Western Blot: AFF4 Antibody (2E12) [H00027125-M01] - Analysis of AFF4 expression in transfected 293T cell line by AFF4 monoclonal antibody (M01), clone 2E12.Lane 1: AFF4 transfected lysate( 40.2 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: AFF4 Antibody (2E12) [H00027125-M01] - Analysis of monoclonal antibody to AFF4 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 1 ug/ml.
Sandwich ELISA: AFF4 Antibody (2E12) [H00027125-M01] - Detection limit for recombinant GST tagged AFF4 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
2E12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AFF4 Antibody (2E12) Summary

Immunogen
AFF4 (NP_055238, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKW
Specificity
AFF4 - AF4/FMR2 family, member 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AFF4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AFF4 Antibody (2E12)

  • AF4/FMR2 family, member 4
  • AF5Q31AF4/FMR2 family member 4
  • ALL1-fused gene from chromosome 5q31 protein
  • Major CDK9 elongation factor-associated protein
  • MCEFALL1 fused gene from 5q31
  • MGC75036
  • Protein AF-5q31

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28728
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
NBP1-87714
Species: Hu
Applications: IHC, IHC-P
NBP2-84403
Species: Hu
Applications: WB
NBP2-67811
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-90217
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-82991
Species: Hu
Applications: IHC, IHC-P, WB
H00004298-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB100-40845
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IHC, IHC-P, IP, KD, WB
NBP2-55603
Species: Hu
Applications: ICC/IF, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-31637
Species: Hu
Applications: IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-06069
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
H00085403-B01P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00006827-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
AF5129
Species: Hu
Applications: WB
H00027125-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for AFF4 Antibody (H00027125-M01) (0)

There are no publications for AFF4 Antibody (H00027125-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AFF4 Antibody (H00027125-M01) (0)

There are no reviews for AFF4 Antibody (H00027125-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AFF4 Antibody (H00027125-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AFF4 Products

Bioinformatics Tool for AFF4 Antibody (H00027125-M01)

Discover related pathways, diseases and genes to AFF4 Antibody (H00027125-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AFF4 Antibody (H00027125-M01)

Discover more about diseases related to AFF4 Antibody (H00027125-M01).
 

Pathways for AFF4 Antibody (H00027125-M01)

View related products by pathway.

PTMs for AFF4 Antibody (H00027125-M01)

Learn more about PTMs related to AFF4 Antibody (H00027125-M01).

Blogs on AFF4

There are no specific blogs for AFF4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AFF4 Antibody (2E12) and receive a gift card or discount.

Bioinformatics

Gene Symbol AFF4
Entrez
OMIM
Uniprot