Home » AFF4 » AFF4 Antibodies » AFF4 Antibody (2E12)

AFF4 Antibody (2E12)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: AFF4 Antibody (2E12) [H00027125-M01] - Analysis of AFF4 expression in transfected 293T cell line by AFF4 monoclonal antibody (M01), clone 2E12.Lane 1: AFF4 transfected lysate( 40.2 KDa).Lane 2: Non-transfected lysate.
Western Blot: AFF4 Antibody (2E12) [H00027125-M01] - Analysis of AFF4 expression in transfected 293T cell line by AFF4 monoclonal antibody (M01), clone 2E12.Lane 1: AFF4 transfected lysate( 40.2 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: AFF4 Antibody (2E12) [H00027125-M01] - Analysis of monoclonal antibody to AFF4 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 1 ug/ml.
Sandwich ELISA: AFF4 Antibody (2E12) [H00027125-M01] - Detection limit for recombinant GST tagged AFF4 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
2E12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AFF4 Antibody (2E12) Summary

Immunogen
AFF4 (NP_055238, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKW
Specificity
AFF4 - AF4/FMR2 family, member 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AFF4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AFF4 Antibody (2E12)

  • AF4/FMR2 family, member 4
  • AF5Q31AF4/FMR2 family member 4
  • ALL1-fused gene from chromosome 5q31 protein
  • Major CDK9 elongation factor-associated protein
  • MCEFALL1 fused gene from 5q31
  • MGC75036
  • Protein AF-5q31

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4 Antibody
NBP1-28728
Immunohistochemistry-Paraffin: AF4 Antibody [NBP1-28728] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- AF4 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: AF4 Antibody [NBP1-28728] - Samples: Whole cell lysate (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-AF4 antibody NBP1-28728 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 3 ug/mg lysate. AF4 was also immunoprecipitated by rabbit anti-AF4 antibody NBP1-28705, which recognizes a downstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 10 seconds (B).
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
LAF4 Antibody
NBP1-87714
Immunohistochemistry-Paraffin: LAF4 Antibody [NBP1-87714] - Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.
Species: Hu
Applications: IHC, IHC-P
AFF2 Antibody
NBP2-84403
Western Blot: AFF2 Antibody [NBP2-84403] - WB Suggested Anti-AFF2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: OVCAR-3 cell lysateAFF2 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells
Western Blot: AFF2 Antibody [NBP2-84403] - Host: Rabbit. Target Name: AFF2. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: AFF2 Antibody [NBP2-84403] - Host: Rabbit. Target Name: AFF2. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml
Species: Hu
Applications: WB
Cdk9 Antibody
(SD204-07)
NBP2-67811
Immunocytochemistry/Immunofluorescence: Cdk9 Antibody (SD204-07) [NBP2-67811] - Staining Cdk9 in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunocytochemistry/Immunofluorescence: Cdk9 Antibody (SD204-07) [NBP2-67811] - Staining Cdk9 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: Cdk9 Antibody (SD204-07) [NBP2-67811] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Cdk9 antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF9 Antibody
NBP1-90217
Western Blot: AF9 Antibody [NBP1-90217] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1, using Anti-MLLT3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western Blot: AF9 Antibody [NBP1-90217] - Analysis in human cell line HEL.
Immunohistochemistry-Paraffin: AF9 Antibody [NBP1-90217] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
ELL Antibody
NBP2-82991
Western Blot: ELL Antibody [NBP2-82991] - WB Suggested Anti-ELL Antibody Titration: 7.5ug/ml. ELISA Titer: 1:312500. Positive Control: Transfected 293T
Immunohistochemistry-Paraffin: ELL Antibody [NBP2-82991] - Rabbit Anti-ELL Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X
Species: Hu
Applications: IHC, IHC-P, WB
MLLT1 Antibody
(3H2)
H00004298-M01
Sandwich ELISA: MLLT1 Antibody (3H2) [H00004298-M01] - Detection limit for recombinant GST tagged MLLT1 is approximately 0.1ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: MLLT1 Antibody (3H2) [H00004298-M01] - Analysis of monoclonal antibody to MLLT1 on HeLa cell . Antibody concentration 10 ug/ml.
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
DOT1L Antibody
NB100-40845
Chromatin Immunoprecipitation: DOT1L Antibody [NB100-40845] - Chromatin from KOPN-8 cell line was immunoprecipitated with anti-DOT1L antibody and analyzed by DNA sequencing. The figure illustrates the peak distribution of DOT1L binding within a 250 Kb region of chromosome 10 as detected using anti-DOT1L antibody.
Immunohistochemistry-Paraffin: DOT1L Antibody [NB100-40845] - Human lung carcinoma. Antibody: Affinity purified rabbit anti-DOT1L used at a dilution of 1:200 (1ug/ml). Detection: DAB
Western Blot: DOT1L Antibody [NB100-40845] - siRNA mediated gene silencing of DOT1L validated by Q-PCR and western blot. The results show a down regulation of DOT1L mRNA expression. Empty bars are untreated cells and solid bars are transfected cells. Results from HSkMSC cultures derived from three different experiments on cells at passage three, Graph is presenting means +/- SEM. *, p-value < 0.05 siRNA treated cells compared to controls Image collected and cropped by CiteAb from the following publication (http://respiratory-research.biomedcentral.com/articles/10.1186/s12931-017-0525-x), licensed under a CC-BY licence.
(12 Publications)
Species: Hu, Mu
Applications: CHIP-SEQ, ChIP, IHC, IHC-P, IP, KD, WB
ELL2 Antibody
NBP2-55603
Western Blot: ELL2 Antibody [NBP2-55603] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: ELL2 Antibody [NBP2-55603] - Staining of human cell line SiHa shows localization to nucleoplasm.
Species: Hu
Applications: ICC/IF, WB
Neprilysin/CD10
Antibody [Unconjugate
AF1126
Neprilysin/CD10 was detected in perfusion fixed frozen sections of mouse brain (glial cell in hippocampus) using 15 µg/mL Goat Anti-Mouse Neprilysin/CD10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1126) overnight at 4 °C. Tissue was stained (red) and counterstained (green). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(2 Reviews)
(7 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Protamine 2
Antibody
NBP2-31637
Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human fallopian tube shows low expression as expected.
Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Analysis in human testis and fallopian tube tissues. Corresponding Protamine 2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Protamine 2 Antibody [NBP2-31637] - Staining of human cerebral cortex shows no positivity in neurons as expected.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Protamine 1 Antibody [NBP2-30949] - Staining in human testis and endometrium tissues.. Corresponding PRM1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
RPL22 Antibody
NBP1-06069
Immunohistochemistry-Paraffin: RPL22 Antibody [NBP1-06069] - Staining of paraffin embedded Human Uterus. Antibody at 3.75 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: RPL22 Antibody [NBP1-06069] - Staining of Human Testis. Antibody at 3.75 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: RPL22 Antibody [NBP1-06069] - Staining of paraffin embedded Human Cortex. Antibody at 3.8 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
EAF1 Antibody
H00085403-B01P
Immunocytochemistry/Immunofluorescence: EAF1 Antibody [H00085403-B01P] - Analysis of purified antibody to EAF1 on HeLa cell. (antibody concentration 10 ug/ml)
Immunohistochemistry-Paraffin: EAF1 Antibody [H00085403-B01P] - Analysis of purified antibody to EAF1 on formalin-fixed paraffin-embedded human stomach. (antibody concentration 3 ug/ml)
Western Blot: EAF1 Antibody [H00085403-B01P] - Analysis of EAF1 expression in transfected 293T cell line by EAF1 polyclonal antibody. Lane 1: EAF1 transfected lysate(29.48 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
HSP90 alpha
Antibody - BSA Free
NBP1-77685
Simple Western: HSP90 alpha Antibody [NBP1-77685] - Image shows a specific band for Hsp90A in 0.5 mg/mL of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Suppressor of Ty 4
homolog 1 Antibody (3 ...
H00006827-M01
Western Blot: Suppressor of Ty 4 homolog 1 Antibody (3G4) [H00006827-M01] - Analysis of SUPT4H1 expression in transfected 293T cell line by SUPT4H1 monoclonal antibody (M01), clone 3G4.Lane 1: SUPT4H1 transfected lysate(13.193 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: Suppressor of Ty 4 homolog 1 Antibody (3G4) [H00006827-M01] - Analysis of monoclonal antibody to SUPT4H1 on HeLa cell . Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, WB
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
AFF4 Antibody
(2E12)
H00027125-M01
AFF4 Antibody (2E12)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA

Publications for AFF4 Antibody (H00027125-M01) (0)

There are no publications for AFF4 Antibody (H00027125-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AFF4 Antibody (H00027125-M01) (0)

There are no reviews for AFF4 Antibody (H00027125-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AFF4 Antibody (H00027125-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AFF4 Products

Bioinformatics Tool for AFF4 Antibody (H00027125-M01)

Discover related pathways, diseases and genes to AFF4 Antibody (H00027125-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AFF4 Antibody (H00027125-M01)

Discover more about diseases related to AFF4 Antibody (H00027125-M01).
 

Pathways for AFF4 Antibody (H00027125-M01)

View related products by pathway.

PTMs for AFF4 Antibody (H00027125-M01)

Learn more about PTMs related to AFF4 Antibody (H00027125-M01).

Blogs on AFF4

There are no specific blogs for AFF4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AFF4 Antibody (2E12) and receive a gift card or discount.


Bioinformatics

Gene Symbol AFF4
Entrez
OMIM
Uniprot