AFF4 Antibody (2E12) Summary
Immunogen |
AFF4 (NP_055238, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKW |
Specificity |
AFF4 - AF4/FMR2 family, member 4 |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
AFF4 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactive against transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for AFF4 Antibody (2E12)
Background
AFF4, or AF4/FMR2 family member 4, contains a 127 kDa, 98 kDa, and 39 kDa isoform, and is involved in the process of improving the catalytic rate of RNA polymerase II transcription. Disease research is currently being conducted with AFF4 on its relation to acute lymphoblastic leukemia, as well as other types of leukemia. This protein interacts with SIAH1, CCNT1, MLLT3, MLLT1, and MED10 during the regulation of DNA-dependent transcription and the transcription of RNA polymerase II.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP (-), WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, IHC
Publications for AFF4 Antibody (H00027125-M01) (0)
There are no publications for AFF4 Antibody (H00027125-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for AFF4 Antibody (H00027125-M01) (0)
There are no reviews for AFF4 Antibody (H00027125-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for AFF4 Antibody (H00027125-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional AFF4 Products
Bioinformatics Tool for AFF4 Antibody (H00027125-M01)
Discover related pathways, diseases and genes to AFF4 Antibody (H00027125-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for AFF4 Antibody (H00027125-M01)
Discover more about diseases related to AFF4 Antibody (H00027125-M01).
| | Pathways for AFF4 Antibody (H00027125-M01)
View related products by pathway.
|
PTMs for AFF4 Antibody (H00027125-M01)
Learn more about PTMs related to AFF4 Antibody (H00027125-M01).
|
Blogs on AFF4