SNF5 Antibody - BSA Free

Staining of human cell line A-431 shows localization to nucleoplasm & vesicles.

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.

Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Analysis in human cell line HEK 293.

Western Blot: SNF5 Antibody [NBP1-90014] - Analysis using Anti-SMARCB1 antibody NBP1-90014 (A) shows similar pattern to independent antibody NBP1-90013 (B).

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNF5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMARCB1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: PFA/Triton X-100
• Control Peptide:

  SNF5 Recombinant Protein Antigen (NBP1-90014PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24335282)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SNF5 Antibody - BSA Free

• BAF47
• BAF47hSNF5
• BRG1-associated factor 47
• hSNFS
• Ini1
• INI1RTPS1
• Integrase interactor 1 protein
• malignant rhabdoid tumor suppressor
• RDTSNF5 homolog
• Sfh1p
• SNF5
• SNF5L1
• Snr1
• subfamily b, member 1
• sucrose nonfermenting, yeast, homolog-like 1
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily B member 1

Background

SNF5 is encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SNF5 Antibody (NBP1-90014)(1)

Publication using NBP1-90014

• Singh AP, Archer TK. Analysis of the SWI/SNF chromatin-remodeling complex during early heart development and BAF250a repression cardiac gene transcription during P19 cell differentiation. Nucleic Acids Res 2014-03-01 [PMID: 24335282]

Bioinformatics

• Gene Symbol: SMARCB1