MLLT6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MLLT6 Antibody [NBP1-89222] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
Immunohistochemistry-Paraffin: MLLT6 Antibody [NBP1-89222] - Staining in human cervix, uterine shows cytoplasmic and nuclear positivity in squamous epithelial cells.
Immunocytochemistry/ Immunofluorescence: MLLT6 Antibody [NBP1-89222] - Staining of human cell line U-2 OS shows positivity in nucleus and mitochondria.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MLLT6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSAPPSPSAPEPPKADLFEQKVVFSGFGPIMRFSTTTSSSGRARAPSPGDYKSPHVTGSGASAGTHKRMPALSATPVPADETPETGLKEKKHKASKRSRHGPGRPKGSRNKEGTGGPAAPSLPSAQLAGFTATAASPFSGGSLVSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLLT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 23945586)
Control Peptide
MLLT6 Protein (NBP1-89222PEP)
Publications
Read Publication using
NBP1-89222 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MLLT6 Antibody

  • AF17Myeloid/lymphoid or mixed-lineage leukemia, translocated to, 6
  • ALL1-fused gene from chromosome 17 protein
  • FLJ23480
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 6
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocatedto, 6
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 6
  • protein AF-17
  • trithorax homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-248
Species: Hu
Applications: WB, IP
NB100-2628
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NB100-1566
Species: Hu
Applications: WB, IP
NBP2-15620
Species: Hu
Applications: WB
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF7829
Species: Hu
Applications: WB, IHC, ICC
NBP1-88351
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74357
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NBP1-19048
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP2-49672
Species: Hu
Applications: IHC
NBP1-89222
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for MLLT6 Antibody (NBP1-89222)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for MLLT6 Antibody (NBP1-89222) (0)

There are no reviews for MLLT6 Antibody (NBP1-89222). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MLLT6 Antibody (NBP1-89222) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MLLT6 Products

Bioinformatics Tool for MLLT6 Antibody (NBP1-89222)

Discover related pathways, diseases and genes to MLLT6 Antibody (NBP1-89222). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLLT6 Antibody (NBP1-89222)

Discover more about diseases related to MLLT6 Antibody (NBP1-89222).
 

Pathways for MLLT6 Antibody (NBP1-89222)

View related products by pathway.

PTMs for MLLT6 Antibody (NBP1-89222)

Learn more about PTMs related to MLLT6 Antibody (NBP1-89222).

Blogs on MLLT6

There are no specific blogs for MLLT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLLT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLLT6