AF10 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: AF10 Antibody [NBP1-90222] - Staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: AF10 Antibody [NBP1-90222] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

ChIP-Exo-Seq composite graph for Anti-MLLT10 (NBP1-90222) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AF10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AF10 Antibody - BSA Free (NBP1-90222) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TPGSVKSSSGSSVQSPQDFLSFTDSDLRNDSYSHSQQSSATKDVHKGESGSQEGGVNSFSTLIGLPSTSAVTSQPKSFENSPGDLGNSSLPTAGYKRAQTSGIEEETVKEKKRKGNKQSKHGPGRPKGNKNQENVSHLSVSSASPTSSV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MLLT10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AF10 Protein (NBP1-90222PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AF10 Antibody - BSA Free

• AF10MGC75086
• ALL1-fused gene from chromosome 10 protein
• DKFZp686E10210
• myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 10
• myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 10
• protein AF-10
• type I AF10 protein

Background

AF10 is a putative transcription factor containing a leucine zipper motif. A t(10;11)(p12;q23) chromosomal translocation present in a proportion of acute myeloid leukaemias results in expression of an AF10 (carboxy terminus) MLL (amino terminus) fusion protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MLLT10
• Entrez:
  • 8028(Human)
• Uniprot:
  • P55197(Human)