ELL Antibody

Images

 
Immunohistochemistry-Paraffin: ELL Antibody [NBP2-13955] - Staining of human testis shows moderate nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ANMSAKDGTCTLQDCMYKDVQKDWPGYSEGDQQLLKRVLVRKLCQPQSTG SLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQ PAVNGKLG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ELL Protein (NBP2-13955PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ELL Antibody

  • C19orf17
  • chromosome 19 open reading frame 17
  • DKFZp434I1916
  • Eleven-nineteen lysine-rich leukemia protein
  • ELL gene (11-19 lysine-rich leukemia gene)
  • ELL1
  • elongation factor RNA polymerase II
  • MEN
  • RNA polymerase II elongation factor ELL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF482
Species: Mu
Applications: WB, IHC
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-35213
Species: Hu
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB600-248
Species: Hu
Applications: WB, IP
NB100-485
Species: Hu
Applications: WB, IP
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
MAB4077
Species: Hu
Applications: WB, IHC
MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP

Publications for ELL Antibody (NBP2-13955) (0)

There are no publications for ELL Antibody (NBP2-13955).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELL Antibody (NBP2-13955) (0)

There are no reviews for ELL Antibody (NBP2-13955). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ELL Antibody (NBP2-13955) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELL Products

Bioinformatics Tool for ELL Antibody (NBP2-13955)

Discover related pathways, diseases and genes to ELL Antibody (NBP2-13955). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELL Antibody (NBP2-13955)

Discover more about diseases related to ELL Antibody (NBP2-13955).
 

Pathways for ELL Antibody (NBP2-13955)

View related products by pathway.

PTMs for ELL Antibody (NBP2-13955)

Learn more about PTMs related to ELL Antibody (NBP2-13955).

Blogs on ELL

There are no specific blogs for ELL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELL