MIA3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MIA3 Antibody [NBP2-34160] - Staining of human cell line U-251 MG shows localization to vesicles.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-34160] - Analysis in human testis and skeletal muscle tissues unsing Anti-MIA3 antibody. Corresponding MIA3 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-34160] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: MIA3 Antibody [NBP2-34160] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MIA3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEETATLVMAPPLEEGLGGAMEEMQPLHEDNFSREKTAELNVQVPEEPTHLDQRVI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MIA3 Protein (NBP2-34160PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MIA3 Antibody

  • ARNT
  • C219 Reactive Peptide
  • C219-Reactive Peptide
  • D320
  • KIAA0268
  • Melanoma Inhibitory Activity Family, Member 3
  • Melanoma Inhibitory Activity Protein 3
  • TANGO
  • TANGO1
  • Transport And Golgi Organization Protein 1
  • Transport And Golgi Organization
  • UNQ6077

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2289
Species: Hu, Mu, Rt, Gp
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ma, Pm, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, IHC-FrFl, KD, KO, LA
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
NBP1-88619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC, IHC-P, In vitro
NBP3-10508
Species: Hu
Applications: WB
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Rb, Re, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PAGE, Dual ISH-IHC, KD, KO
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-88623
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-41398
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Ma, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-41384
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, KO
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD

Publications for MIA3 Antibody (NBP2-34160) (0)

There are no publications for MIA3 Antibody (NBP2-34160).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIA3 Antibody (NBP2-34160) (0)

There are no reviews for MIA3 Antibody (NBP2-34160). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MIA3 Antibody (NBP2-34160) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MIA3 Products

Array NBP2-34160

Bioinformatics Tool for MIA3 Antibody (NBP2-34160)

Discover related pathways, diseases and genes to MIA3 Antibody (NBP2-34160). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIA3 Antibody (NBP2-34160)

Discover more about diseases related to MIA3 Antibody (NBP2-34160).
 

Pathways for MIA3 Antibody (NBP2-34160)

View related products by pathway.

Blogs on MIA3

There are no specific blogs for MIA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIA3
Uniprot