Mena Antibody

Images

 
Western Blot: Mena Antibody [NBP1-87915] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: Mena Antibody [NBP1-87915] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & focal adhesion sites.
Immunohistochemistry-Paraffin: Mena Antibody [NBP1-87915] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: Mena Antibody [NBP1-87915] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Mena Antibody [NBP1-87915] - Staining in human prostate and liver tissues using anti-ENAH antibody. Corresponding ENAH RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mena Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSN
Specificity
Specificity of human Mena antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENAH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Mena Protein (NBP1-87915PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mena Antibody

  • ENA
  • enabled homolog (Drosophila)
  • ENAH
  • FLJ10773
  • Mena
  • MENANDPP1
  • NDPP1
  • protein enabled homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85792
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38132
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-33549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
NBP1-82512
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB110-58360
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19344
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-18783
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87915
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Mena Antibody (NBP1-87915) (0)

There are no publications for Mena Antibody (NBP1-87915).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mena Antibody (NBP1-87915) (0)

There are no reviews for Mena Antibody (NBP1-87915). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Mena Antibody (NBP1-87915) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mena Products

Bioinformatics Tool for Mena Antibody (NBP1-87915)

Discover related pathways, diseases and genes to Mena Antibody (NBP1-87915). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mena Antibody (NBP1-87915)

Discover more about diseases related to Mena Antibody (NBP1-87915).
 

Pathways for Mena Antibody (NBP1-87915)

View related products by pathway.

PTMs for Mena Antibody (NBP1-87915)

Learn more about PTMs related to Mena Antibody (NBP1-87915).
 

Research Areas for Mena Antibody (NBP1-87915)

Find related products by research area.

Blogs on Mena

There are no specific blogs for Mena, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mena Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENAH
Entrez