BAIAP2 Antibody

Images

 
Western Blot: BAIAP2 Antibody [NBP1-88711] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: BAIAP2 Antibody [NBP1-88711] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: BAIAP2 Antibody [NBP1-88711] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Western Blot: BAIAP2 Antibody [NBP1-88711] - Analysis in human cell line U-138 MG.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BAIAP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BAIAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BAIAP2 Protein (NBP1-88711PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BAIAP2 Antibody

  • BAI1-associated protein 2IRS-58
  • BAI-associated protein 2
  • BAP2
  • brain-specific angiogenesis inhibitor 1-associated protein 2
  • Fas ligand-associated factor 3
  • FLAF3
  • Insulin receptor substrate p53
  • Insulin receptor substrate p53/p58
  • Insulin receptor substrate protein of 53 kDa
  • IRSP53
  • IRSp53/58
  • Protein BAP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89537
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF5514
Species: Hu, Mu
Applications: WB
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27300
Species: Hu
Applications: WB, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB100-59845
Species: Hu
Applications: IP (-), WB, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BAIAP2 Antibody (NBP1-88711) (0)

There are no publications for BAIAP2 Antibody (NBP1-88711).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BAIAP2 Antibody (NBP1-88711) (0)

There are no reviews for BAIAP2 Antibody (NBP1-88711). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BAIAP2 Antibody (NBP1-88711) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BAIAP2 Products

Bioinformatics Tool for BAIAP2 Antibody (NBP1-88711)

Discover related pathways, diseases and genes to BAIAP2 Antibody (NBP1-88711). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BAIAP2 Antibody (NBP1-88711)

Discover more about diseases related to BAIAP2 Antibody (NBP1-88711).
 

Pathways for BAIAP2 Antibody (NBP1-88711)

View related products by pathway.

PTMs for BAIAP2 Antibody (NBP1-88711)

Learn more about PTMs related to BAIAP2 Antibody (NBP1-88711).

Blogs on BAIAP2

There are no specific blogs for BAIAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BAIAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BAIAP2