N-WASP Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining in human cerebral cortex and skeletal muscle tissues . Corresponding WASL RNA-seq data are presented for the same ...read more
Western Blot: N-WASP Antibody [NBP1-82512] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: N-WASP Antibody [NBP1-82512] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Western Blot: N-WASP Antibody [NBP1-82512] - Analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal cells.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human kidney shows moderate to strong positivity in cells in tubules and glomeruli.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human skeletal muscle shows weak positivity in myocytes.
Immunohistochemistry-Paraffin: N-WASP Antibody [NBP1-82512] - Staining of human stomach shows moderate to strong positivity in glandular cells.
Simple Western: N-WASP Antibody [NBP1-82512] - Simple Western lane view shows a specific band for N-WASP in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions ...read more
Genetic Strategies: Knockdown Validated: N-WASP Antibody [NBP1-82512] - Generation of N-WASP knockdown cell lines. A-549 and SK-MES-1 cells were treated with N-WASP siRNA/non-targeting siRNA (NT) at 0.5 ug/ml and ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

N-WASP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WASL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID:28351346). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
N-WASP Protein (NBP1-82512PEP)
Publications
Read Publications using
NBP1-82512 in the following applications:

  • 2 publications
  • WB
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23091069).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for N-WASP Antibody

  • NWASP
  • N-WASP
  • N-WASPneural WiskNWASP
  • TRS4
  • WASL
  • WiskDKFZp779G0847
  • WiskMGC48327

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF1444
Species: Mu
Applications: IHC, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75395
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP3-15508
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-13180
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-75585
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-00555
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
236-EG
Species: Hu
Applications: BA
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB4675
Species: Mu
Applications: IHC, Neut, WB
NBP1-88838
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00057016-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

Publications for N-WASP Antibody (NBP1-82512)(5)

Reviews for N-WASP Antibody (NBP1-82512) (0)

There are no reviews for N-WASP Antibody (NBP1-82512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for N-WASP Antibody (NBP1-82512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-WASP Products

Bioinformatics Tool for N-WASP Antibody (NBP1-82512)

Discover related pathways, diseases and genes to N-WASP Antibody (NBP1-82512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-WASP Antibody (NBP1-82512)

Discover more about diseases related to N-WASP Antibody (NBP1-82512).
 

Pathways for N-WASP Antibody (NBP1-82512)

View related products by pathway.

PTMs for N-WASP Antibody (NBP1-82512)

Learn more about PTMs related to N-WASP Antibody (NBP1-82512).
 

Research Areas for N-WASP Antibody (NBP1-82512)

Find related products by research area.

Blogs on N-WASP.

Repurposing FDA-approved drugs to combat the rise of antibiotic resistance
By Beth Melson, MSAntibiotic resistance is a global threat to public health. Widespread, inappropriate use of antibiotics, such as to treat viral infections or promote growth in livestock, has led to increased incid...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-WASP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WASL