MEF2D Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MEF2D Antibody [NBP1-85795] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85795] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85795] - Analysis in human skeletal muscle and liver tissues. Corresponding MEF2D RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85795] - Staining of human kidney, liver, placenta and skeletal muscle using Anti-MEF2D antibody NBP1-85795 (A) shows similar protein distribution across tissues to independent antibody NBP1-85788 (B).

Immunohistochemistry-Paraffin: MEF2D Antibody [NBP1-85795] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.

Staining of human skeletal muscle shows strong nuclear positivity in myocytes.

Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Analysis in control (vector only transfected HEK293T lysate) and MEF2D over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MEF2D Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAG
• Predicted Species: Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MEF2D
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MEF2D Protein (NBP1-85795PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MEF2D Antibody - BSA Free

• DKFZp686I1536
• MADS box transcription enhancer factor 2, polypeptide D (myocyte enhancerfactor 2D)
• MEF2D/DAZAP1 fusion
• myocyte enhancer factor 2D
• myocyte enhancer factor 2D/deleted in azoospermia associated protein 1 fusionprotein
• myocyte-specific enhancer factor 2D

Background

Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific, growth factor- and stress-induced genes. Mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. Plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. Plays a critical role in the regulation of neuronal apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MEF2D