MED28 Antibody

Western Blot: MED28 Antibody [NBP1-85104] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: MED28 Antibody [NBP1-85104] - Staining of human placenta shows nuclear positivity in trophoblastic cells.

Western Blot: MED28 Antibody [NBP1-85104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MED28 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED28
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MED28 Protein (NBP1-85104PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MED28 Antibody

• DKFZP434N185
• EG1DKFZp434N185
• magicin
• mediator complex subunit 281500003D12Rik
• mediator of RNA polymerase II transcription, subunit 28 homolog (S. cerevisiae)
• subunit 28 homolog

Background

MED28 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNApolymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatoryproteins to the basal RNA polymerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED28