MED28 Antibody

Images

 
Western Blot: MED28 Antibody [NBP1-85104] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: MED28 Antibody [NBP1-85104] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: MED28 Antibody [NBP1-85104] - Staining of human hippocampus shows moderate cytoplasmic and nuclear membranous positivity in neurons.
Western Blot: MED28 Antibody [NBP1-85104] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED28 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED28
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED28 Protein (NBP1-85104PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED28 Antibody

  • DKFZP434N185
  • EG1DKFZp434N185
  • magicin
  • mediator complex subunit 281500003D12Rik
  • mediator of RNA polymerase II transcription, subunit 28 homolog (S. cerevisiae)
  • subunit 28 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF3534
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91872
Species: Hu
Applications: IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB38461
Species: Hu
Applications: WB, IHC
NBP1-85104
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MED28 Antibody (NBP1-85104) (0)

There are no publications for MED28 Antibody (NBP1-85104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED28 Antibody (NBP1-85104) (0)

There are no reviews for MED28 Antibody (NBP1-85104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MED28 Antibody (NBP1-85104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED28 Products

Bioinformatics Tool for MED28 Antibody (NBP1-85104)

Discover related pathways, diseases and genes to MED28 Antibody (NBP1-85104). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED28 Antibody (NBP1-85104)

Discover more about diseases related to MED28 Antibody (NBP1-85104).
 

Pathways for MED28 Antibody (NBP1-85104)

View related products by pathway.

PTMs for MED28 Antibody (NBP1-85104)

Learn more about PTMs related to MED28 Antibody (NBP1-85104).

Blogs on MED28

There are no specific blogs for MED28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED28