GRB2 Antibody (9K6H0)

Western Blot: GRB2 Antibody (9K6H0) [NBP3-15638] - Analysis of extracts of various cell lines, using GRB2 antibody (NBP3-15638) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Immunocytochemistry/Immunofluorescence: GRB2 Antibody (9K6H0) [NBP3-15638] - Immunofluorescence analysis of HeLa cells using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Mouse spleen using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Rat spleen using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Human lung cancer using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunoprecipitation: GRB2 Antibody (9K6H0) [NBP3-15638] - Analysis of 300ug extracts of 293T cells using 3ug GRB2 antibody (NBP3-15638). Western blot was performed from the immunoprecipitate using GRB2 (NBP3-15638) at a dilition of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P, IP
• Clone: 9K6H0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

GRB2 Antibody (9K6H0) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 118-217 of human GRB2 (P62993). YFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: GRB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Notes

"The only hazardous substance, Thimerosal, is present in this product in very small amounts as an antimicrobial preservative."

Alternate Names for GRB2 Antibody (9K6H0)

• abundant SRC homology
• Adapter protein GRB2
• ASH
• EGFRBP-GRB2
• epidermal growth factor receptor-binding protein GRB2
• GRB2
• Grb3-3
• growth factor receptor-bound protein 2
• growth factor receptor-bound protein 3
• HT027
• MST084
• MSTP084
• NCKAP2
• Protein Ash
• SH2/SH3 adapter GRB2

Background

The growth factor bound protein 2 (GRB2) is a 25 kDa cytosolic protein that contains one src homology (SH2) domain and two SH3 domains (1). GRB2 associates with Tyrosine phosphorylated EGFRs and PDGFRs via its SH2 domain. GRB2 also plays a crucial role in two separate insulin pathways leading from the insulin receptor to the Ras protein thus affecting mitogenic signaling (2). Additionally GBR2, a bifunctional adaptor protein, recruits Sos for Ras activation and subsequent signal transmission (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GRB2