GRB2 Antibody (9K6H0)

Images

 
Western Blot: GRB2 Antibody (9K6H0) [NBP3-15638] - Analysis of extracts of various cell lines, using GRB2 antibody (NBP3-15638) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. ...read more
Immunocytochemistry/ Immunofluorescence: GRB2 Antibody (9K6H0) [NBP3-15638] - Immunofluorescence analysis of HeLa cells using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Mouse spleen using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before ...read more
Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Rat spleen using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before ...read more
Immunohistochemistry-Paraffin: GRB2 Antibody (9K6H0) [NBP3-15638] - Human lung cancer using GRB2 Rabbit mAb (NBP3-15638) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 ...read more
Immunoprecipitation: GRB2 Antibody (9K6H0) [NBP3-15638] - Analysis of 300ug extracts of 293T cells using 3ug GRB2 antibody (NBP3-15638). Western blot was performed from the immunoprecipitate using GRB2 (NBP3-15638) at a ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IP
Clone
9K6H0
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRB2 Antibody (9K6H0) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 118-217 of human GRB2 (P62993). YFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
GRB2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GRB2 Antibody (9K6H0)

  • abundant SRC homology
  • Adapter protein GRB2
  • ASH
  • EGFRBP-GRB2
  • epidermal growth factor receptor-binding protein GRB2
  • GRB2
  • Grb3-3
  • growth factor receptor-bound protein 2
  • growth factor receptor-bound protein 3
  • HT027
  • MST084
  • MSTP084
  • NCKAP2
  • Protein Ash
  • SH2/SH3 adapter GRB2

Background

The growth factor bound protein 2 (GRB2) is a 25 kDa cytosolic protein that contains one src homology (SH2) domain and two SH3 domains (1). GRB2 associates with Tyrosine phosphorylated EGFRs and PDGFRs via its SH2 domain. GRB2 also plays a crucial role in two separate insulin pathways leading from the insulin receptor to the Ras protein thus affecting mitogenic signaling (2). Additionally GBR2, a bifunctional adaptor protein, recruits Sos for Ras activation and subsequent signal transmission (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRB2 Antibody (NBP3-15638) (0)

There are no publications for GRB2 Antibody (NBP3-15638).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRB2 Antibody (NBP3-15638) (0)

There are no reviews for GRB2 Antibody (NBP3-15638). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRB2 Antibody (NBP3-15638) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRB2 Products

Research Areas for GRB2 Antibody (NBP3-15638)

Find related products by research area.

Blogs on GRB2

There are no specific blogs for GRB2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRB2 Antibody (9K6H0) and receive a gift card or discount.

Bioinformatics

Gene Symbol GRB2