MDH1 Antibody (8U9X1)

Western Blot: MDH1 Antibody (8U9X1) [NBP3-16860] - Western blot analysis of extracts of various cell lines, using MDH1 Rabbit mAb (NBP3-16860) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 8U9X1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MDH1 Antibody (8U9X1) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 235-334 of human MDH1 (P40925). IKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MDH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MDH1 Antibody (8U9X1)

• aromatic alpha-keto acid reductase
• cytoplasmic
• Cytosolic malate dehydrogenase
• DEE88
• Diiodophenylpyruvate reductase
• EC 1.1.1.37
• EC 1.1.1.96
• EIEE88
• epididymis secretory protein Li 32
• HEL-S-32
• KAR
• malate dehydrogenase 1, NAD (soluble)
• Malate dehydrogenase, cytoplasmic
• malate dehydrogenase, cytoplasmic; malate dehydrogenase, peroxisomal
• MDH1
• MDHA
• MDH-s
• MGC:1375
• MOR2
• soluble malate dehydrogenase

Background

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MDH1