MCT2 Antibody

Images

 
Western Blot: MCT2 Antibody [NBP2-85265] - Host: Rabbit. Target Name: SLC16A7. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml
Western Blot: MCT2 Antibody [NBP2-85265] - Host: Rabbit. Target: SLC16A7. Positive control (+): Human Fetal Heart (HE). Negative control (-): Human Brain (BR). Antibody concentration: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MCT2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human MCT2. Peptide sequence: LAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC16A7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Simple Western
  • Western Blot 1.0 ug/ml
Application Notes
Simple Western reported by an internal validation. Separated by Size-Jess/Wes, Sally Sue/Peggy Sue, antibody dilution of 1:50.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MCT2 Antibody

  • MCT 2
  • MCT2
  • MCT2solute carrier family 16 (monocarboxylic acid transporters), member 7
  • monocarboxylate transporter 2
  • SLC16A7
  • Solute carrier family 16 member 7
  • solute carrier family 16, member 7 (monocarboxylic acid transporter 2)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59656
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-03626
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-81251
Species: Hu, Mu
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-13315
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3998
Species: Hu
Applications: WB
H00027349-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
NB100-64848
Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-66872
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-59885
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24689
Species: Hu, Mu
Applications: WB
NBP2-57308
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB8398
Species: Hu
Applications: CyTOF-ready, Flow
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-85265
Species: Hu
Applications: WB, Simple Western

Publications for MCT2 Antibody (NBP2-85265) (0)

There are no publications for MCT2 Antibody (NBP2-85265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCT2 Antibody (NBP2-85265) (0)

There are no reviews for MCT2 Antibody (NBP2-85265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCT2 Antibody (NBP2-85265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MCT2 Products

Bioinformatics Tool for MCT2 Antibody (NBP2-85265)

Discover related pathways, diseases and genes to MCT2 Antibody (NBP2-85265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCT2 Antibody (NBP2-85265)

Discover more about diseases related to MCT2 Antibody (NBP2-85265).
 

Pathways for MCT2 Antibody (NBP2-85265)

View related products by pathway.

PTMs for MCT2 Antibody (NBP2-85265)

Learn more about PTMs related to MCT2 Antibody (NBP2-85265).
 

Research Areas for MCT2 Antibody (NBP2-85265)

Find related products by research area.

Blogs on MCT2

There are no specific blogs for MCT2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC16A7