We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MAP2 Antibody - BSA Free

Images

 
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Staining of human cell line SH-SY5Y shows localization to cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

MAP2 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MAP2 Antibody - BSA Free

  • DKFZp686I2148
  • MAP2
  • MAP-2
  • MAP2A
  • MAP2B
  • MAP2C
  • Microtubule Associated Protein 2
  • microtubule-associated protein 2
  • MTAP2

Background

Microtubule-associated protein 2 also known as MAP2 (theoretical molecular weight 280 kDa) belongs to the MAP2/Tau family which in addition to the two neuronal forms MAP2 and Tau also includes MAP4 (1). For MAP2, four different isoforms have been identified which are produced through alternative splicing including MAP2a, MAP2b, MAP2c and MAP2d (1). MAP2 isoforms contain multiple microtubule-binding domains located near the carboxy terminal, a variably sized amino-terminal projection domain, and a conserved protein kinase A binding domain. MAP2c and MAP2d isoforms have a shorter amino-terminal projection domain, lower molecular weight and are identifiable at ~70 kDa in SDS-PAGE analysis (2,3). MAP2's carboxy terminal domain supports interactions with microtubules, actin, and intermediate filaments (2).

MAP2 isoforms are developmentally regulated and differentially expressed in neurons and some glia. MAP2c is predominantly expressed in the developing brain while the other isoforms are expressed in the adult brain. The distribution of MAP2 isoforms also varies, with MAP2a and MAP2b predominantly localized to dendrites, while MAP2c is also found in axons. Lastly, the expression of MAP2d is not limited to neurons and may be found in glia, specifically oligodendrocytes (1, 2). MAP2 isoforms associate with microtubules and mediate their interaction with actin filaments thereby playing a critical role in organizing the microtubule-actin network. In neurons, MAP2 isoforms are implicated in different processes including neurite initiation, elongation and stabilization as well as axon and dendrite formation (2). Knockout of MAP expression in animal models results in a variety of functional and structural brain defects according to the isoform affected (e.g., reduced LTP and LTD, reduced myelination, absence of corpus collosum, motor system malfunction, abnormal hippocampal dendritic morphology, abnormal synaptic plasticity) (4).

References

1. Dehmelt, L., & Halpain, S. (2005). The MAP2/Tau family of microtubule-associated proteins. Genome Biology. https://doi.org/10.1186/gb-2004-6-1-204

2. Mohan, R., & John, A. (2015). Microtubule-associated proteins as direct crosslinkers of actin filaments and microtubules. IUBMB Life. https://doi.org/10.1002/iub.1384

3. Shafit-Zagardo, B., & Kalcheva, N. (1998). Making sense of the multiple MAP-2 transcripts and their role in the neuron. Molecular Neurobiology. https://doi.org/10.1007/BF02740642

4. Tortosa, E., Kapitein, L. C., & Hoogenraad, C. C. (2016). Microtubule organization and microtubule-associated proteins (MAPs). In Dendrites: Development and Disease. https://doi.org/10.1007/978-4-431-56050-0_3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, Simple Western, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-653
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP1-42827
Species: Ch, Fi, Hu, Pm, Mu, Rt, Re, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
DBD00
Species: Hu
Applications: ELISA
H00000759-M07
Species: Hu
Applications: ELISA, WB
H00064112-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
233-FB
Species: Hu
Applications: BA
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
NB110-58870
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
AF1724
Species: Hu
Applications: IP, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB

Publications for MAP2 Antibody (NBP3-21231) (0)

There are no publications for MAP2 Antibody (NBP3-21231).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP2 Antibody (NBP3-21231) (0)

There are no reviews for MAP2 Antibody (NBP3-21231). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAP2 Antibody (NBP3-21231) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP2 Products

Research Areas for MAP2 Antibody (NBP3-21231)

Find related products by research area.

Blogs on MAP2.

Methamphetamine with HIV induces mitochondrial dysfunction and neuronal injury through oxidative stress
By Jamshed Arslan, Pharm. D., PhD. December 1 is the World AIDS Day. Despite the combination antiretroviral therapy, 10-25% of Human Immunodeficiency Virus (HIV)-positive individuals report neurocognitive impairm...  Read full blog post.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Beta Tubulin III and neurogenesis
Beta tubulin III, also known as Tuj-1, is a class III member of the beta tubulin protein family. Beta tubulins are one of two structural components that form our microtubule network. While general tubulins play a role in a wide range of cellular pr...  Read full blog post.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP2