MAG/Siglec-4a Antibody (8Q7K5) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAG/Siglec-4a (P20916). MIFLTALPLFWIMISASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNC |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
MAG |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Western Blot 1:500 - 1:1000
|
Theoretical MW |
69 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for MAG/Siglec-4a Antibody (8Q7K5)
Background
Myelin-associated glycoprotein (MAG), a membrane glycoprotein of 100 kDa, is thought to be involved in the process of myelination (1). Axonal regeneration in the adult central nervous system (CNS) is limited by two proteins in myelin, Nogo and MAG (2). MAG has been implicated in inhibition of nerve regeneration in the CNS. This results from interactions between MAG and the Nogo receptor and gangliosides on the apposing axon, which generates intracellular inhibitory signals in the neuron (3). Results also suggest that MAG binds to a specific receptor and initiates a signal transduction cascade to effect inhibition. These results indicate that soluble dMAG detected in vivo could contribute to the lack of regeneration in the mammalian CNS after injury (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Mu
Applications: WB
Species: Hu, Mu, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Publications for MAG/Siglec-4a Antibody (NBP3-16859) (0)
There are no publications for MAG/Siglec-4a Antibody (NBP3-16859).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MAG/Siglec-4a Antibody (NBP3-16859) (0)
There are no reviews for MAG/Siglec-4a Antibody (NBP3-16859).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MAG/Siglec-4a Antibody (NBP3-16859) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MAG/Siglec-4a Products
Research Areas for MAG/Siglec-4a Antibody (NBP3-16859)
Find related products by research area.
|
Blogs on MAG/Siglec-4a