RPLP0 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RPLP0 Antibody [NBP1-82859] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & endoplasmic reticulum.
Immunohistochemistry-Paraffin: RPLP0 Antibody [NBP1-82859] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPLP0 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGIT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPLP0
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RPLP0 Protein (NBP1-82859PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RPLP0 Antibody

  • 60S acidic ribosomal protein P0
  • 60S ribosomal protein L10E
  • acidic ribosomal phosphoprotein P0
  • L10E
  • MGC111226
  • MGC88175
  • P0
  • PRLP0
  • ribosomal protein, large, P0
  • RPP0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
H00000518-R01
Species: Hu
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI

Publications for RPLP0 Antibody (NBP1-82859) (0)

There are no publications for RPLP0 Antibody (NBP1-82859).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPLP0 Antibody (NBP1-82859) (0)

There are no reviews for RPLP0 Antibody (NBP1-82859). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RPLP0 Antibody (NBP1-82859) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPLP0 Products

Bioinformatics Tool for RPLP0 Antibody (NBP1-82859)

Discover related pathways, diseases and genes to RPLP0 Antibody (NBP1-82859). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPLP0 Antibody (NBP1-82859)

Discover more about diseases related to RPLP0 Antibody (NBP1-82859).
 

Pathways for RPLP0 Antibody (NBP1-82859)

View related products by pathway.

PTMs for RPLP0 Antibody (NBP1-82859)

Learn more about PTMs related to RPLP0 Antibody (NBP1-82859).

Blogs on RPLP0

There are no specific blogs for RPLP0, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPLP0 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RPLP0