Lysyl Oxidase Homolog 2/LOXL2 Antibody (3C5)

Images

 
Sandwich ELISA: Lysyl Oxidase Homolog 2/LOXL2 Antibody (3C5) [H00004017-M05] - Detection limit for recombinant GST tagged LOXL2 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Lysyl Oxidase Homolog 2/LOXL2 Antibody (3C5) Summary

Immunogen
LOXL2 (NP_002309 675 a.a. - 773 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP
Specificity
LOXL2 - lysyl oxidase-like 2 (3C5)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LOXL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 Review rated 4
using
H00004017-M05 in the following applications:

Publications
Read Publication using H00004017-M05.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lysyl Oxidase Homolog 2/LOXL2 Antibody (3C5)

  • EC 1.4.3
  • EC 1.4.3.-
  • LOL2
  • LOR2
  • LOXL2
  • Lysyl Oxidase Homolog 2
  • lysyl oxidase related 2
  • lysyl oxidase-like 2
  • Lysyl oxidase-like protein 2
  • Lysyl oxidase-related protein 2
  • Lysyl oxidase-related protein WS9-14
  • WS9-14

Background

This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00084695-A01
Species: Hu
Applications: WB, ELISA
NBP1-82827
Species: Hu
Applications: IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
H00084171-M01
Species: Hu
Applications: WB, ELISA
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46231
Species: Hu
Applications: WB, IHC
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for Lysyl Oxidase Homolog 2/LOXL2 Antibody (H00004017-M05)(1)

Review for Lysyl Oxidase Homolog 2/LOXL2 Antibody (H00004017-M05) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using H00004017-M05:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Human 06/14/2010
View

Summary

ApplicationWestern Blot
Sample TestedMDA435 cell extract, Sample Amount: 50 ug
SpeciesHuman
Lot07359-3C5
CommentsSaw expected bands.

Blocking

Blocking DetailsBlocking Buffer: 5% milk in TBST, Blocking Time: 1 hour, Blocking Temp: 22 degrees Celsius

Primary Anitbody

Dilution RatioDilution Ratio: 1:500, Incubation Dilution Buffer: 5% Milk in TBST, Incubation Time: overnight, Incubation Temp: 4 C

Secondary Antibody

Secondary DescriptionSecondary Ab: anti-mouse, Secondary Ab Dilution Ratio: 1:2500
Secondary Manufacturer Cat#sc-2371

Details

Detection NotesDetection Method: HRP, Exposure Time: 5 minutes, Specific Bands: ~80 kDa, Non-Specific Bands: many bands below 80 kDa

Comments

CommentsSaw expected bands.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lysyl Oxidase Homolog 2/LOXL2 Antibody (H00004017-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lysyl Oxidase Homolog 2/LOXL2 Products

Bioinformatics Tool for Lysyl Oxidase Homolog 2/LOXL2 Antibody (H00004017-M05)

Discover related pathways, diseases and genes to Lysyl Oxidase Homolog 2/LOXL2 Antibody (H00004017-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lysyl Oxidase Homolog 2/LOXL2 Antibody (H00004017-M05)

Discover more about diseases related to Lysyl Oxidase Homolog 2/LOXL2 Antibody (H00004017-M05).
 

Pathways for Lysyl Oxidase Homolog 2/LOXL2 Antibody (H00004017-M05)

View related products by pathway.

PTMs for Lysyl Oxidase Homolog 2/LOXL2 Antibody (H00004017-M05)

Learn more about PTMs related to Lysyl Oxidase Homolog 2/LOXL2 Antibody (H00004017-M05).

Blogs on Lysyl Oxidase Homolog 2/LOXL2

There are no specific blogs for Lysyl Oxidase Homolog 2/LOXL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

 
Anonymous
06/14/2010
Application: WB
Species: Human

Bioinformatics

Gene Symbol LOXL2
Entrez
Uniprot