Lymphotoxin beta R/TNFRSF3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Lymphotoxin beta R/TNFRSF3 Antibody - BSA Free (NBP2-68777) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LTBR |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Lymphotoxin beta R/TNFRSF3 Antibody - BSA Free
Background
LT-beta-R, also known as lymphotoxin beta receptor and tumor necrosis factor receptor superfamily member 3 is a 47 kD transmembrane protein containing 3 TNF receptor domains. The LT-beta-R is a receptor for the heterotrimeric lymphotoxin complex (composed of LT alpha and LT beta as well as LIGHT. LT-beta-R is highly expressed in the lung, liver, and kidney and moderately expressed expressed in the heart and testes. LT-beta-R is weakly expressed in the brain, thymus, spleen, and lymph nodes. The cytoplasmic tail of LT-beta-R interacts with TRAF3, TRAF4, and TRAF5 as well as the hepatitis C virus core protein. Ligand binding to LT-beta-R has been shown to induce apoptosis (via TRAF3 and TRAF5) and play a role in the development of lymphoid organs.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Publications for Lymphotoxin beta R/TNFRSF3 Antibody (NBP2-68777) (0)
There are no publications for Lymphotoxin beta R/TNFRSF3 Antibody (NBP2-68777).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Lymphotoxin beta R/TNFRSF3 Antibody (NBP2-68777) (0)
There are no reviews for Lymphotoxin beta R/TNFRSF3 Antibody (NBP2-68777).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Lymphotoxin beta R/TNFRSF3 Antibody (NBP2-68777) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Lymphotoxin beta R/TNFRSF3 Products
Research Areas for Lymphotoxin beta R/TNFRSF3 Antibody (NBP2-68777)
Find related products by research area.
|
Blogs on Lymphotoxin beta R/TNFRSF3