LSS Antibody


Western Blot: LSS Antibody [NBP1-53166] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: LSS Antibody [NBP1-53166] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

LSS Antibody Summary

Synthetic peptides corresponding to LSS(lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)) The peptide sequence was selected from the middle region of LSS. Peptide sequence KCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against LSS and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LSS Antibody

  • EC
  • FLJ350152,3-epoxysqualene--lanosterol cyclase
  • FLJ39450
  • FLJ46393
  • hOSC
  • human lanosterol synthase, EC 5.4.99
  • lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)2,3-epoxysqualene-lanosterol cyclase
  • lanosterol synthase
  • OSCFLJ25486
  • Oxidosqualene--lanosterol cyclase


LSS catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. It is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene.The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP (-), WB
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for LSS Antibody (NBP1-53166) (0)

There are no publications for LSS Antibody (NBP1-53166).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LSS Antibody (NBP1-53166) (0)

There are no reviews for LSS Antibody (NBP1-53166). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LSS Antibody (NBP1-53166) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LSS Products

Bioinformatics Tool for LSS Antibody (NBP1-53166)

Discover related pathways, diseases and genes to LSS Antibody (NBP1-53166). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LSS Antibody (NBP1-53166)

Discover more about diseases related to LSS Antibody (NBP1-53166).

Pathways for LSS Antibody (NBP1-53166)

View related products by pathway.

PTMs for LSS Antibody (NBP1-53166)

Learn more about PTMs related to LSS Antibody (NBP1-53166).

Blogs on LSS

There are no specific blogs for LSS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LSS Antibody and receive a gift card or discount.


Gene Symbol LSS