Lipocalin-2/NGAL Antibody

Images

 
Western Blot: Lipocalin-2/NGAL Antibody [NBP1-90331] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: Lipocalin-2/NGAL Antibody [NBP1-90331] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: Lipocalin-2/NGAL Antibody [NBP1-90331] - Staining of human spleen shows strong cytoplasmic positivity in subsets of cells in the red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lipocalin-2/NGAL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lipocalin-2/NGAL Protein (NBP1-90331PEP)
Publications
Read Publications using
NBP1-90331 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23736029).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lipocalin-2/NGAL Antibody

  • 24p3
  • 25 kDa alpha-2-microglobulin-related subunit of MMP-9
  • HNL
  • LCN2
  • lipocalin 2 (oncogene 24p3)
  • lipocalin 2
  • Lipocalin2
  • Lipocalin-2
  • migration-stimulating factor inhibitor
  • MSFI
  • neutrophil gelatinase-associated lipocalin
  • NGAL
  • NGALlipocalin-2
  • Oncogene 24p3
  • p25
  • Siderocalin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for Lipocalin-2/NGAL Antibody (NBP1-90331)(3)

Reviews for Lipocalin-2/NGAL Antibody (NBP1-90331) (0)

There are no reviews for Lipocalin-2/NGAL Antibody (NBP1-90331). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lipocalin-2/NGAL Antibody (NBP1-90331) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lipocalin-2/NGAL Products

Bioinformatics Tool for Lipocalin-2/NGAL Antibody (NBP1-90331)

Discover related pathways, diseases and genes to Lipocalin-2/NGAL Antibody (NBP1-90331). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lipocalin-2/NGAL Antibody (NBP1-90331)

Discover more about diseases related to Lipocalin-2/NGAL Antibody (NBP1-90331).
 

Pathways for Lipocalin-2/NGAL Antibody (NBP1-90331)

View related products by pathway.

PTMs for Lipocalin-2/NGAL Antibody (NBP1-90331)

Learn more about PTMs related to Lipocalin-2/NGAL Antibody (NBP1-90331).
 

Research Areas for Lipocalin-2/NGAL Antibody (NBP1-90331)

Find related products by research area.

Blogs on Lipocalin-2/NGAL

There are no specific blogs for Lipocalin-2/NGAL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lipocalin-2/NGAL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCN2
Entrez