Lipocalin-2/NGAL Antibody - BSA Free

Analysis in human bone marrow and testis tissues using NBP1-90331 antibody. Corresponding LCN2 RNA-seq data are presented for the same tissues.

Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Staining of human kidney shows strong granular cytoplasmic positivity in subset of cells in tubules.

Analysis in Capan-2 cells transfected with control siRNA, target specific siRNA probe #1. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu
• Applications: WB, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Lipocalin-2/NGAL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Lipocalin-2/NGAL Antibody - BSA Free (NBP1-90331) is a polyclonal antibody validated for use in IHC and WB. Anti-Lipocalin-2/NGAL Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LCN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Lipocalin-2/NGAL Protein (NBP1-90331PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23736029).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Lipocalin-2/NGAL Antibody - BSA Free

• 24p3
• 25 kDa alpha-2-microglobulin-related subunit of MMP-9
• HNL
• LCN2
• lipocalin 2 (oncogene 24p3)
• lipocalin 2
• Lipocalin2
• Lipocalin-2
• migration-stimulating factor inhibitor
• MSFI
• neutrophil gelatinase-associated lipocalin
• NGAL
• NGALlipocalin-2
• Oncogene 24p3
• p25
• Siderocalin
• Uterocalin

Background

Lipocalin 2 is a member of the lipocalin family which encompass more than 25 members (including proteins like retinol binding protein, a1 microglobulin, b lactoglobulin, apolipoprotein D, odorant binding protein). The members of the lipocalin family are characterized by their ability to bind small lipophilic substances in their hydrophobic core, and thereby serve as transporters of substances.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Lipocalin-2/NGAL Antibody (NBP1-90331)(5)

Publications using NBP1-90331

• Candido S, Maestro R, Polesel J et al. Roles of neutrophil gelatinase-associated lipocalin (NGAL) in human cancer. Oncotarget 2014-03-30 [PMID: 24742531] (IF/IHC, Human)
• McLean MH, Thomson AJ, Murray GI et al. Expression of neutrophil gelatinase-associated lipocalin in colorectal neoplastic progression: a marker of malignant potential?. Br J Cancer 2013-06-25 [PMID: 23736029] (IF/IHC, Human)
• Rathore KI, Berard JL, Redensek A et al. Lipocalin 2 plays an immunomodulatory role and has detrimental effects after spinal cord injury. J Neurosci 2011-09-01 [PMID: 21940434]
• Kahraman DS, Diniz G, Sayhan S Over expressions of neutrophil gelatinase-associated lipocalin and kidney injury molecule-1 in human uterine cervical neoplasms enhance tumor invasion European Journal of Gynaecological Oncology 2021-02-02 (IHC-P, Human)
• Diniz G, Pulular AG, Solakoglu Kahraman D et al. Tissue Expression of Neutrophil Gelatinase-Associated Lipocalin and Kidney Injury Molecule-1 in Breast Cancers European journal of breast health 2022-10-01 [PMID: 36248749] (IHC-P, Human)

Bioinformatics

• Gene Symbol: LCN2