Lipase A Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Analysis in human spleen and skeletal muscle tissues. Corresponding Lipase A RNA-seq data are presented for the same tissues.
Western Blot: Lipase A Antibody [NBP2-47397] - Analysis in human spleen tissue.
Immunocytochemistry/ Immunofluorescence: Lipase A Antibody [NBP2-47397] - Staining of human cell line A-431 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: Lipase A Antibody [NBP2-47397] - Staining of human lymphoid tissues shows strong cytoplasmic positivity in a subset of non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Lipase A Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIPA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Lipase A Protein (NBP2-47397PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Lipase A Antibody - BSA Free

  • Acid cholesteryl ester hydrolase
  • CESD
  • Cholesteryl esterase
  • EC 3.1.1
  • EC 3.1.1.13
  • LALCESDcholesterol ester hydrolase
  • LIPA
  • Lipase A
  • lipase A, lysosomal acid, cholesterol esterase
  • lysosomal acid lipase
  • lysosomal acid lipase/cholesteryl ester hydrolase
  • Sterol esterase

Background

Lipase A, also known as LIPA or Lysosomal acid lipase/cholesteryl ester hydrolase, has a 399 amino acid long isoform that is 45 kDa and a short 343 amino acid isoform that is 39 kDa; lysosome located; is very important for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles, and also in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation. This protein is currently being studied for involvement in the following diseases and disorders: cholesteryl ester storage disease, wolman disease, cholesterol, cholesterol ester storage disease, lysosomal storage disease, coronary heart disease, hepatitis c, splenomegaly, hepatitis b, hepatitis, hyperlipidemia, hypercholesterolemia, tuberculosis, obesity atherosclerosis, alzheimer's disease, neisseria meningitides, lipid storage disease, lipodystrophy, pandas, wolman disease, and blepharitis. The LIPA protein has been shown to interact with HIST1H4A, HIST1H4B, HIST1H4C, SOAT1, and HIST1H4E in cholesterol and sphingolipids transport / distribution to the intracellular membrane compartments (normal and CF), steroid biosynthesis, and lysosome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-88502
Species: Hu
Applications: IHC,  IHC-P
NBP1-85691
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF5365
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-02948
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
M6000B
Species: Mu
Applications: ELISA
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB8306
Species: Hu
Applications: IHC, WB
NB110-40760
Species: Fi, Hu, Mu, Po, Rt
Applications: Flow, IMC, ICC/IF, IHC,  IHC-P, WB
NBP1-88057
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-47397
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for Lipase A Antibody (NBP2-47397) (0)

There are no publications for Lipase A Antibody (NBP2-47397).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lipase A Antibody (NBP2-47397) (0)

There are no reviews for Lipase A Antibody (NBP2-47397). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Lipase A Antibody (NBP2-47397) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lipase A Products

Research Areas for Lipase A Antibody (NBP2-47397)

Find related products by research area.

Blogs on Lipase A.

How do Lipase A and the CD36 Antibody Relate to Each Other
Obesity, diabetes and metabolic disorders are dramatically on the increase, linked to disorders such as heart disease, stroke and cancer. To combat this, research groups are studying metabolism at both a cellular and a systemic level. Although we at N...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lipase A Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol LIPA