Carboxyl Ester Lipase/CEL Antibody


Independent Antibodies: Immunohistochemistry-Paraffin: Carboxyl Ester Lipase/CEL Antibody [NBP1-88502] - Staining of human breast, cerebral cortex, liver and pancreas using Anti-CEL antibody NBP1-88502 (A) shows more
Immunohistochemistry-Paraffin: Carboxyl Ester Lipase/CEL Antibody [NBP1-88502] - Staining of human lactating breast shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Carboxyl Ester Lipase/CEL Antibody [NBP1-88502] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Carboxyl Ester Lipase/CEL Antibody [NBP1-88502] - Staining of human pancreas shows high expression.
Immunohistochemistry-Paraffin: Carboxyl Ester Lipase/CEL Antibody [NBP1-88502] - Staining of human cerebral cortex using Anti-CEL antibody.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Carboxyl Ester Lipase/CEL Antibody [NBP1-88502] - Staining in human pancreas and liver tissues using anti-CEL antibody. Corresponding CEL RNA-seq data are more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Carboxyl Ester Lipase/CEL Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSG
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Carboxyl Ester Lipase/CEL Protein (NBP1-88502PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Carboxyl Ester Lipase/CEL Antibody

  • BAL
  • bile salt-activated lipase
  • Bile salt-stimulated lipase
  • BSDL
  • BSSL
  • BSSLbile salt-dependent lipase, oncofetal isoform
  • bucelipase
  • carboxyl ester hydrolase
  • carboxyl ester lipase (bile salt-stimulated lipase)
  • Carboxyl Ester Lipase
  • CEase
  • CEL
  • CELL
  • Cholesterol esterase
  • EC 3.1.1
  • EC
  • EC
  • FAP
  • FAPP
  • fetoacinar pancreatic protein
  • LIPA
  • lysophospholipase, pancreatic
  • MODY8bile-salt-activated lipase
  • Pancreatic lysophospholipase
  • Sterol esterase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for Carboxyl Ester Lipase/CEL Antibody (NBP1-88502) (0)

There are no publications for Carboxyl Ester Lipase/CEL Antibody (NBP1-88502).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carboxyl Ester Lipase/CEL Antibody (NBP1-88502) (0)

There are no reviews for Carboxyl Ester Lipase/CEL Antibody (NBP1-88502). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Carboxyl Ester Lipase/CEL Antibody (NBP1-88502) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Carboxyl Ester Lipase/CEL Products

Bioinformatics Tool for Carboxyl Ester Lipase/CEL Antibody (NBP1-88502)

Discover related pathways, diseases and genes to Carboxyl Ester Lipase/CEL Antibody (NBP1-88502). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carboxyl Ester Lipase/CEL Antibody (NBP1-88502)

Discover more about diseases related to Carboxyl Ester Lipase/CEL Antibody (NBP1-88502).

Pathways for Carboxyl Ester Lipase/CEL Antibody (NBP1-88502)

View related products by pathway.

PTMs for Carboxyl Ester Lipase/CEL Antibody (NBP1-88502)

Learn more about PTMs related to Carboxyl Ester Lipase/CEL Antibody (NBP1-88502).

Research Areas for Carboxyl Ester Lipase/CEL Antibody (NBP1-88502)

Find related products by research area.

Blogs on Carboxyl Ester Lipase/CEL

There are no specific blogs for Carboxyl Ester Lipase/CEL, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Carboxyl Ester Lipase/CEL Antibody and receive a gift card or discount.


Gene Symbol CEL