Lipase A Antibody - Azide and BSA Free

Western Blot: Lipase A Antibody [H00003988-D01P] - Analysis of LIPA expression in K-562.

Western Blot: Lipase A Antibody [H00003988-D01P] - Analysis of LIPA expression in transfected 293T cell line by LIPA polyclonal antibody.Lane 1: LIPA transfected lysate(45.40 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Lipase A Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: LIPA (AAH12287.1, 1 a.a. - 399 a.a.) full-length human protein. MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
• Specificity: LIPA - lipase A, lysosomal acid, cholesterol esterase (Wolman disease),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LIPA
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Lipase A Antibody - Azide and BSA Free

• Acid cholesteryl ester hydrolase
• CESD
• Cholesteryl esterase
• EC 3.1.1
• EC 3.1.1.13
• LALCESDcholesterol ester hydrolase
• LIPA
• Lipase A
• lipase A, lysosomal acid, cholesterol esterase
• lysosomal acid lipase
• lysosomal acid lipase/cholesteryl ester hydrolase
• Sterol esterase

Background

This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Lipase A Antibody (H00003988-D01P)(1)

Publication using H00003988-D01P

• Roszell BR, Tao JQ, Yu KJ et al. Characterization of the Niemann-Pick C pathway in alveolar type II cells and lamellar bodies of the lung. Am J Physiol Lung Cell Mol Physiol. 2012-02-24 [PMID: 22367786]

Bioinformatics

• Gene Symbol: LIPA
• Entrez:
  • 3988(Human)
• Uniprot:
  • AAH12287.1(Human)