LIAS Antibody


Western Blot: LIAS Antibody [NBP1-82845] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: LIAS Antibody [NBP1-82845] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human hippocampus shows cytoplasmic positivity in neuronal cells.
Immunocytochemistry/ Immunofluorescence: LIAS Antibody [NBP1-82845] - Staining of mouse cerebellum shows positivity in Purkinje cell bodies and dendrites.
Immunocytochemistry/ Immunofluorescence: LIAS Antibody [NBP1-82845] - Staining of mouse lateral ventricle shows nuclear labeling in a subset of cells in the choroid plexus and lateral ventricle wall.
Immunocytochemistry/ Immunofluorescence: LIAS Antibody [NBP1-82845] - Staining of mouse subfornical organ shows nuclear positivity in a subset of cells.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human cerebral cortex shows cytoplasmic positivity in neurons.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

LIAS Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLK
Specificity of human, mouse, rat LIAS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LIAS Protein (NBP1-82845PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LIAS Antibody

  • EC
  • LASmitochondrial
  • LIP1
  • lipoic acid synthetase
  • Lip-syn
  • MGC23245


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for LIAS Antibody (NBP1-82845) (0)

There are no publications for LIAS Antibody (NBP1-82845).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIAS Antibody (NBP1-82845) (0)

There are no reviews for LIAS Antibody (NBP1-82845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LIAS Antibody (NBP1-82845) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LIAS Products

Bioinformatics Tool for LIAS Antibody (NBP1-82845)

Discover related pathways, diseases and genes to LIAS Antibody (NBP1-82845). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIAS Antibody (NBP1-82845)

Discover more about diseases related to LIAS Antibody (NBP1-82845).

Pathways for LIAS Antibody (NBP1-82845)

View related products by pathway.

PTMs for LIAS Antibody (NBP1-82845)

Learn more about PTMs related to LIAS Antibody (NBP1-82845).

Blogs on LIAS

There are no specific blogs for LIAS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LIAS Antibody and receive a gift card or discount.


Gene Symbol LIAS