LIAS Antibody

Images

 
Western Blot: LIAS Antibody [NBP1-82845] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: LIAS Antibody [NBP1-82845] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry: LIAS Antibody [NBP1-82845] - Staining of mouse lateral ventricle shows positivity in a subset of cells in choroid plexus and lateral ventricle wall.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.
Immunohistochemistry: LIAS Antibody [NBP1-82845] - Staining of mouse subfornical organ shows nuclear positivity in a subset of cells.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human hippocampus shows weak cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry: LIAS Antibody [NBP1-82845] - Staining of mouse cerebellum shows moderate cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIAS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIAS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LIAS Protein (NBP1-82845PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIAS Antibody

  • EC 2.8.1.8
  • LASmitochondrial
  • LIP1
  • lipoic acid synthetase
  • Lip-syn
  • MGC23245

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-39087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
210-TA/CF
Species: Hu
Applications: BA
MAB7665
Species: Hu
Applications: IHC, WB
NBP1-56929
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
664-LI/CF
Species: Hu
Applications: BA
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB

Publications for LIAS Antibody (NBP1-82845) (0)

There are no publications for LIAS Antibody (NBP1-82845).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIAS Antibody (NBP1-82845) (0)

There are no reviews for LIAS Antibody (NBP1-82845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LIAS Antibody (NBP1-82845) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIAS Products

Array NBP1-82845

Bioinformatics Tool for LIAS Antibody (NBP1-82845)

Discover related pathways, diseases and genes to LIAS Antibody (NBP1-82845). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIAS Antibody (NBP1-82845)

Discover more about diseases related to LIAS Antibody (NBP1-82845).
 

Pathways for LIAS Antibody (NBP1-82845)

View related products by pathway.

PTMs for LIAS Antibody (NBP1-82845)

Learn more about PTMs related to LIAS Antibody (NBP1-82845).

Blogs on LIAS

There are no specific blogs for LIAS, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIAS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIAS