LIAS Antibody

Immunocytochemistry/Immunofluorescence: LIAS Antibody [NBP1-82845] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.

Immunohistochemistry: LIAS Antibody [NBP1-82845] - Staining of mouse lateral ventricle shows positivity in a subset of cells in choroid plexus and lateral ventricle wall.

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human cerebellum shows cytoplasmic immunoreactivity in Purkinje cells.

Immunohistochemistry: LIAS Antibody [NBP1-82845] - Staining of mouse subfornical organ shows nuclear positivity in a subset of cells.

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human hippocampus shows weak cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: LIAS Antibody [NBP1-82845] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry: LIAS Antibody [NBP1-82845] - Staining of mouse cerebellum shows moderate cytoplasmic positivity in neurons.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

LIAS Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLK
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LIAS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LIAS Protein (NBP1-82845PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LIAS Antibody

• EC 2.8.1.8
• LASmitochondrial
• LIP1
• lipoic acid synthetase
• Lip-syn
• MGC23245

Background

LIAS is encoded by this gene belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LIAS