LGSN Antibody


Western Blot: LGSN Antibody [NBP2-85207] - WB Suggested Anti-LGSN Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell

Product Details

Reactivity Hu, CaSpecies Glossary
Applications WB

Order Details

LGSN Antibody Summary

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LGSN. Peptide sequence: QEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMR The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Canine (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for LGSN Antibody

  • GLULD1
  • glutamate-ammonia ligase (glutamine synthase) domain containing 1
  • glutamate-ammonia ligase (glutamine synthetase) domain containing 1
  • Glutamate-ammonia ligase domain-containing protein 1
  • lengsin
  • lengsin, lens protein with glutamine synthetase domain
  • Lens glutamine synthase-like
  • LGSMGC163240
  • MGC163238


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Bv
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Po, Ca, Fe, Gt, Gp, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Ca
Applications: WB

Publications for LGSN Antibody (NBP2-85207) (0)

There are no publications for LGSN Antibody (NBP2-85207).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LGSN Antibody (NBP2-85207) (0)

There are no reviews for LGSN Antibody (NBP2-85207). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LGSN Antibody (NBP2-85207) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LGSN Products

Bioinformatics Tool for LGSN Antibody (NBP2-85207)

Discover related pathways, diseases and genes to LGSN Antibody (NBP2-85207). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LGSN Antibody (NBP2-85207)

Discover more about diseases related to LGSN Antibody (NBP2-85207).

Pathways for LGSN Antibody (NBP2-85207)

View related products by pathway.

Blogs on LGSN

There are no specific blogs for LGSN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LGSN Antibody and receive a gift card or discount.


Gene Symbol LGSN