Home » Lgr5/GPR49 » Lgr5/GPR49 Antibodies » Lgr5/GPR49 Antibody

Lgr5/GPR49 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Lgr5/GPR49 Antibody [NBP2-54660] - Staining of human colon shows cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Lgr5/GPR49 Antibody [NBP2-54660] - Staining of human colon shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Lgr5/GPR49 Antibody Summary

Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: AIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LGR5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Lgr5/GPR49 Recombinant Protein Antigen (NBP2-54660PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lgr5/GPR49 Antibody

  • FEX
  • G protein-coupled receptor 49
  • GPR49
  • GPR49G-protein coupled receptor HG38
  • GPR67
  • G-protein coupled receptor 49
  • G-protein coupled receptor 67
  • GRP49
  • HG38
  • leucine-rich repeat containing G protein-coupled receptor 5
  • leucine-rich repeat-containing G protein-coupled receptor 5
  • leucine-rich repeat-containing G-protein coupled receptor 5
  • Lgr5
  • MGC117008
  • orphan G protein-coupled receptor HG38

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD133 Antibody -
BSA Free
NB120-16518
Chromatin Immunoprecipitation: CD133 Antibody [NB120-16518] - [NB 120-16518] - Staining CD133 in Bone Marrow Mononuclear Cells by Immunofluorescence.
Flow Cytometry: CD133 Antibody [NB120-16518] - Flow Cytometry: CD133 Antibody [DyLight 488] [NB120-16518G] - Flow Cytometry: CD133 Antibody (DyLight488) [NB120-16518G] - Rat bone marrow cells were stained with CD133 (1:100) antibody (20 minutes at 4C), fixed, and then analyzed. Image using the DyLight 488 form of this antibody.
Immunohistochemistry-Paraffin: CD133 Antibody [NB120-16518] - Staining of CD133 in human hepatocarcinoma (HC) tissue. NB120-16518 was peroxidase-conjugated to the secondary antibody, followed by AEC staining.
(30 Publications)
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
CD44 Antibody
(8E2F3) - BSA Free
NBP1-47386
Flow (Intracellular): CD44 Antibody (8E2F3) [NBP1-47386] - An intracellular stain was performed on HeLa cells with NBP1-47386AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - An intracellular stain was performed on HeLa cells with NBP1-47386AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: CD44 Antibody (8E2F3) [NBP1-47386] - Analysis of HeLa cells using anti-CD44 mAb (right) and negative control (left).
(1 Review)
(16 Publications)
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP
BMI-1 Antibody
(LLBmi1-1) - BSA Free
NBP1-96140
Flow Cytometry: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - An intracellular stain was performed on U2OS cells with BMI-1 Antibody [LLBmi1-1] NBP1-96140AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - An intracellular stain was performed on U2OS cells with BMI-1 [LLBmi1-1] Antibody NBP1-96140 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (84540, Thermo Fisher).
Immunocytochemistry/Immunofluorescence: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti- NBP1-96140 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
Lgr6 Antibody
(918719) [Unconjugate
MAB8458
HEK293 human embryonic kidney cell line transfected with human Lgr6 and eGFP was stained with either (A) Mouse Anti-Human Lgr6 Monoclonal Antibody (Catalog # MAB8458) or (B) Mouse IgG1 Isotype Control (Catalog # MAB002) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B).
Lgr6 was detected in immersion fixed HEK293 human embryonic kidney cell line transfected with human Lgr6 and eGFP (green) using Mouse Anti-Human Lgr6 Monoclonal Antibody (Catalog # MAB8458) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Musashi-1 Antibody
[Unconjugated]
AF2628
Western blot shows 25 ng of Recombinant Human Musashi-1 and Recombinant Human Musashi-2. PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse/Rat Musashi‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2628) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Musashi‑1 at approximately 39 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Musashi‑1 was detected in immersion fixed paraffin-embedded sections of human intestine using 1 µg/mL Goat Anti-Human/Mouse/Rat Musashi‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2628) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells in intestinal glands. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Musashi‑1 was detected in immersion fixed undifferentiated rat cortical stem cells using Goat Anti-Human/Mouse/Rat Musashi‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2628) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, WB
DCLK1 Antibody -
BSA Free
NBP1-77127
Western Blot: DCLK1 Antibody [NBP1-77127] - Human brain tissue lysate with DCAMILK1 antibody at (A) 0.5 and (B) 1 ug/mL.
Immunohistochemistry-Paraffin: DCLK1 Antibody [NBP1-77127] - Rat brain tissue with DCAMLK1 antibody at 2.5 ug/mL.
Immunocytochemistry/Immunofluorescence: DCLK1 Antibody [NBP1-77127] - Staining of DCLK1 in mouse brain tissue with DCLK1 Antibodyat 20 ug/mL.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Lgr4/GPR48
Antibody (852229) [Un ...
MAB7750
Lgr4/GPR48 was detected in immersion fixed HT‑29 human colon adenocarcinoma cell line using Mouse Anti-Human Lgr4/GPR48 Monoclonal Antibody (Catalog # MAB7750) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
HEK293 human embryonic kidney cell line transfected with human Lgr4/GPR48 and eGFP was stained with and either (A) Mouse Anti-Human Lgr4/GPR48 Monoclonal Antibody (Catalog # MAB7750) or (B) Mouse IgG2B Flow Cytometry Isotype Control (Catalog # MAB0041) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody(Catalog # F0101B). View our protocol for Staining Membrane-associated Proteins.
In a functional flow cytometry test, biotinylated Recombinant Human R-Spondin 4 (100 ng/mL) binds to HEK293 human embryonic kidney cell line transfected with human Lgr4/GPR48 (dark orange histogram). Binding is completely blocked (light orange histogram) by 2.5 μg/mL of Mouse Anti-Human Lgr4/GPR48 Monoclonal Antibody (Catalog # MAB7750). Mouse IgG2B Isotype Control (Catalog # MAB004) at 2.5 μg/mL was used as a control (blue line). Cells were stained with Streptavidin-APC (Catalog # F0050).
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC
Oct-3/4 Antibody
[Unconjugated]
AF1759
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Oct‑3/4/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human/Mouse Oct‑3/4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1759) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Alkaline phosphatase (ALPL) and Oct‑3/4 were detected in human BG01V embryonic stem cells using 10 µg/mL Human/Mouse/Rat ALPL Monoclonal Antibody (Catalog # MAB1448) and 10 µg/mL Goat Anti-Human/Mouse Oct‑3/4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1759). Cells were incubated with primary antibodies for 3 hours at room temperature. Cells were stained for ALPL using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (pseudo-stained green; Catalog # NL007), and stained for Oct-3/4 using the NorthernLights 637-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL002). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of BG01V human embryonic stem cells and NTera‑2 human testicular embryonic carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Oct‑3/4 at approximately 50 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse Oct‑3/4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1759) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Reviews)
(33 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(4 Reviews)
(16 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ALCAM/CD166
Antibody [Unconjugate
AF1172
ALCAM/CD166 was detected in perfusion fixed frozen sections of mouse liver using Goat Anti-Mouse/Rat/Canine ALCAM/CD166 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1172) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
ALCAM/CD166 was detected in immersion fixed undifferentiated rat mesenchymal stem cells using Goat Anti-Mouse/Rat/Canine ALCAM/CD166 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1172) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of mouse brain (cerebellumn) tissue, rat brain (cerebellum) tissue, H4‑II‑E‑C3 rat hepatoma cell line, and U‑118‑MG human glioblastoma/astrocytoma cell line. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Mouse/Rat/Canine ALCAM/CD166 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1172) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ALCAM/CD166 at approximately 90-120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Reviews)
(13 Publications)
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(3 Publications)
Species: Hu
Applications: BA
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/Immunofluorescence: APC Antibody [NB100-91662] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-APC Antibody at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: APC Antibody [NB100-91662] - An intracellular stain was performed on HeLa cells with APC Antibody NB100-91662AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunohistochemistry-Paraffin: APC Antibody [NB100-91662] - Paraffin-embedded human colon carcinoma tissue.
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IL-13 [HRP]
M1300CB
(3 Reviews)
(127 Publications)
Species: Mu
Applications: ELISA
Doublecortin
Antibody
NBP1-72042
Western Blot: Doublecortin Antibody [NBP1-72042] - staining of Mouse fetal Brain lysate (35 ug protein in RIPA buffer). Antibody at 0.01 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (5 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL).
Immunocytochemistry/Immunofluorescence: Doublecortin Antibody [NBP1-72042] - Immunofluorescence analysis of paraformaldehyde fixed KNRK cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
R-Spondin 1
[Unconjugated]
7150-RS/CF
Measured by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells. The typical ED50 is 8-40 ng/mL in the presence of 5 ng/mL Recombinant Mouse Wnt‑3a (1324-WN).
(8 Publications)
Species: Mu
Applications: BA
CD24 Antibody
(ML5) - BSA Free
NB100-77903
Flow Cytometry: CD24 Antibody (ML5) [NB100-77903] - Analysis using the FITC conjugate of NB100-77903. Staining of Human peripheral blood lymphocytes stained ML5 FITC.
Flow Cytometry: CD24 Antibody (ML5) [NB100-77903] - Whole blood lymphocytes stained with purified ML5 and detected with anti-mouse IgGs FITC
Immunocytochemistry/Immunofluorescence: CD24 Antibody (ML5) [NB100-77903] - MCF-7 breast cancer cells.
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Lgr5/GPR49 Antibody
NBP2-54660
Lgr5/GPR49 Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for Lgr5/GPR49 Antibody (NBP2-54660) (0)

There are no publications for Lgr5/GPR49 Antibody (NBP2-54660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lgr5/GPR49 Antibody (NBP2-54660) (0)

There are no reviews for Lgr5/GPR49 Antibody (NBP2-54660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Lgr5/GPR49 Antibody (NBP2-54660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Lgr5/GPR49 Products

Bioinformatics Tool for Lgr5/GPR49 Antibody (NBP2-54660)

Discover related pathways, diseases and genes to Lgr5/GPR49 Antibody (NBP2-54660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lgr5/GPR49 Antibody (NBP2-54660)

Discover more about diseases related to Lgr5/GPR49 Antibody (NBP2-54660).
 

Pathways for Lgr5/GPR49 Antibody (NBP2-54660)

View related products by pathway.

PTMs for Lgr5/GPR49 Antibody (NBP2-54660)

Learn more about PTMs related to Lgr5/GPR49 Antibody (NBP2-54660).
 

Research Areas for Lgr5/GPR49 Antibody (NBP2-54660)

Find related products by research area.

Blogs on Lgr5/GPR49.

Check out the latest blog posts on Lgr5/GPR49.
Meeting Report: 2nd International Antibody Validation Meeting
Bio-Techne brands Novus Biologicals® and R&D Systems® were proud to support the 2nd International Antibody Validation Meeting held at Bath University, on the 15-16 September, 2016. Almost 100 participants from around the world, including funde...  Read full blog post.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lgr5/GPR49 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LGR5