LEDGF Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

LEDGF Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSIP1.
  
  

  Source: E. coli

  Amino Acid Sequence: KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PSIP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87885.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LEDGF Recombinant Protein Antigen

• CLL-associated antigen KW-7
• Dense fine speckles 70 kDa protein
• DFS 70
• DFS70
• LEDGF
• LEDGFDFS 70
• Lens epithelium-derived growth factor
• MGC74712
• p52
• p75
• PAIP
• PC4 and SFRS1 interacting protein 1
• PC4 and SFRS1 interacting protein 2
• PC4 and SFRS1-interacting protein
• PSIP1
• PSIP2
• transcriptional coactivator p52/p75
• Transcriptional coactivator p75/p52

Background

The human p75 protein is a non TAF transcription coactivator that mediates activator dependent transcription by RNA polymerase II in vitro through most tested activators. Although p75 and p52 are derived from alternatively splicing of a single gene and share most coding sequence, they reveal different function in several aspects. In addition to functioning as a transcription coactivator, p75 has been reported to be involved in regulating growth of epithelial cells, pathogenesis of atopic dermatitis and activity of HIV1 integrase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PSIP1