| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 3H1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse LEDGF Antibody (3H1) - Azide and BSA Free (H00011168-M01) is a monoclonal antibody validated for use in IHC, WB and ELISA. Anti-LEDGF Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET |
| Specificity | PSIP1 - PC4 and SFRS1 interacting protein 1 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PSIP1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00011168-M01 | Applications | Species |
|---|---|---|
| Shun MC, Raghavendra NK, Vandegraaff N et al. LEDGF/p75 functions downstream from preintegration complex formation to effect gene-specific HIV-1 integration. Genes Dev. 2007-07-15 [PMID: 17639082] |
Secondary Antibodies |
Isotype Controls |
Research Areas for LEDGF Antibody (H00011168-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.