LEDGF Antibody (1C4) - Azide and BSA Free

Western Blot: LEDGF Antibody (1C4) [H00011168-M02] - PSIP1 monoclonal antibody (M02), clone 1C4. Analysis of PSIP1 expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: LEDGF Antibody (1C4) [H00011168-M02] - Analysis of monoclonal antibody to PSIP1 on HeLa cell . Antibody concentration 10 ug/ml.

Western Blot: LEDGF Antibody (1C4) [H00011168-M02] - PSIP1 monoclonal antibody (M02), clone 1C4. Analysis of PSIP1 expression in human kidney.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1C4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LEDGF Antibody (1C4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse LEDGF Antibody (1C4) - Azide and BSA Free (H00011168-M02) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET
• Specificity: PSIP1 - PC4 and SFRS1 interacting protein 1 (1C4)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PSIP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LEDGF Antibody (1C4) - Azide and BSA Free

• CLL-associated antigen KW-7
• Dense fine speckles 70 kDa protein
• DFS 70
• DFS70
• LEDGF
• LEDGFDFS 70
• Lens epithelium-derived growth factor
• MGC74712
• p52
• p75
• PAIP
• PC4 and SFRS1 interacting protein 1
• PC4 and SFRS1 interacting protein 2
• PC4 and SFRS1-interacting protein
• PSIP1
• PSIP2
• transcriptional coactivator p52/p75
• Transcriptional coactivator p75/p52

Background

The human p75 protein is a non TAF transcription coactivator that mediates activator dependent transcription by RNA polymerase II in vitro through most tested activators. Although p75 and p52 are derived from alternatively splicing of a single gene and share most coding sequence, they reveal different function in several aspects. In addition to functioning as a transcription coactivator, p75 has been reported to be involved in regulating growth of epithelial cells, pathogenesis of atopic dermatitis and activity of HIV1 integrase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSIP1
• Entrez:
  • 11168(Human)
• Uniprot:
  • AAH33817(Human)