LAMP-1/CD107a Antibody

Images

 
Immunohistochemistry: LAMP-1/CD107a Antibody [NBP1-86557] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LAMP-1/CD107a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCN
Marker
Late Endosome Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LAMP-1/CD107a Protein (NBP1-86557PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LAMP-1/CD107a Antibody

  • CD107 antigen-like family member A
  • CD107a antigen
  • CD107a
  • LAMP1
  • LAMP-1
  • LAMPA
  • LGP120
  • lysosomal-associated membrane protein 1
  • lysosome-associated membrane glycoprotein 1
  • Lysosome-associated membrane protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-42225
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
AF1029
Species: Mu
Applications: WB, IHC, IP
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
AF873
Species: Hu
Applications: WB
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
NBP1-86557
Species: Hu
Applications: IHC, IHC-P

Publications for LAMP-1/CD107a Antibody (NBP1-86557) (0)

There are no publications for LAMP-1/CD107a Antibody (NBP1-86557).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAMP-1/CD107a Antibody (NBP1-86557) (0)

There are no reviews for LAMP-1/CD107a Antibody (NBP1-86557). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LAMP-1/CD107a Antibody (NBP1-86557) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LAMP-1/CD107a Products

Bioinformatics Tool for LAMP-1/CD107a Antibody (NBP1-86557)

Discover related pathways, diseases and genes to LAMP-1/CD107a Antibody (NBP1-86557). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LAMP-1/CD107a Antibody (NBP1-86557)

Discover more about diseases related to LAMP-1/CD107a Antibody (NBP1-86557).
 

Pathways for LAMP-1/CD107a Antibody (NBP1-86557)

View related products by pathway.

PTMs for LAMP-1/CD107a Antibody (NBP1-86557)

Learn more about PTMs related to LAMP-1/CD107a Antibody (NBP1-86557).

Blogs on LAMP-1/CD107a

There are no specific blogs for LAMP-1/CD107a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LAMP-1/CD107a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMP1
Entrez