Kv6.1 Antibody

Images

 
Western Blot: Kv6.1 Antibody [NBP1-80098] - Kv6.1 Antibody MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kv6.1 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human KCNG1. Peptide sequence YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against KCNG1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Kv6.1 Antibody

  • KCNG
  • KH2
  • kH2K13
  • KV6.1
  • MGC12878
  • potassium channel KH2
  • potassium channel Kv6.1
  • potassium voltage-gated channel subfamily G member 1
  • potassium voltage-gated channel, subfamily G, member 1
  • Voltage-gated potassium channel subunit Kv6.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29429
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC, Single Cell Western
NBP2-61736
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, IHC
NBP2-34355
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-67706
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-78278
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-38166
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB7619
Species: Hu
Applications: WB, Simple Western, IHC, ICC
7559-ST
Species: Hu
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-62639
Species: Hu
Applications: IHC, IHC-P
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P
NBP2-14144
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34844
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P

Publications for Kv6.1 Antibody (NBP1-80098) (0)

There are no publications for Kv6.1 Antibody (NBP1-80098).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv6.1 Antibody (NBP1-80098) (0)

There are no reviews for Kv6.1 Antibody (NBP1-80098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Kv6.1 Antibody (NBP1-80098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Kv6.1 Antibody (NBP1-80098)

Discover related pathways, diseases and genes to Kv6.1 Antibody (NBP1-80098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv6.1 Antibody (NBP1-80098)

Discover more about diseases related to Kv6.1 Antibody (NBP1-80098).

Blogs on Kv6.1

There are no specific blogs for Kv6.1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv6.1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNG1
Uniprot