KLHDC2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KLHDC2 Antibody [NBP2-14163] - Immunofluorescent staining of human cell line RH-30 shows localization to nuclear bodies & nuclear membrane.
Immunohistochemistry-Paraffin: KLHDC2 Antibody [NBP2-14163] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry: KLHDC2 Antibody [NBP2-14163] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KLHDC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MADGNEDLRADDLPGPAFESYESMELACPAERSGHVAVSDGRHMFVWGGY KSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDVPPSMSGSCAVCVD RVLYLFGGHHSRGNTNKFYMLDSRSTDRVLQWERIDCQGIPPSSKDKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLHDC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KLHDC2 Protein (NBP2-14163PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KLHDC2 Antibody

  • HCA33
  • HCLP-1Host cell factor-like protein 1
  • Hepatocellular carcinoma-associated antigen 33
  • Host cell factor homolog LCP
  • kelch domain containing 2
  • kelch domain-containing protein 2
  • LCP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-22568
Species: Hu
Applications: IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00010488-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-14360
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-81208
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11664
Species: Hu
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6465
Species: Hu, Rt
Applications: WB, ICC
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB
AF1724
Species: Hu
Applications: WB, IP
MAB2038
Species: Hu
Applications: Flow, CyTOF-ready, ICC

Publications for KLHDC2 Antibody (NBP2-14163) (0)

There are no publications for KLHDC2 Antibody (NBP2-14163).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLHDC2 Antibody (NBP2-14163) (0)

There are no reviews for KLHDC2 Antibody (NBP2-14163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KLHDC2 Antibody (NBP2-14163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLHDC2 Products

Bioinformatics Tool for KLHDC2 Antibody (NBP2-14163)

Discover related pathways, diseases and genes to KLHDC2 Antibody (NBP2-14163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KLHDC2 Antibody (NBP2-14163)

Discover more about diseases related to KLHDC2 Antibody (NBP2-14163).
 

Pathways for KLHDC2 Antibody (NBP2-14163)

View related products by pathway.

Blogs on KLHDC2

There are no specific blogs for KLHDC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLHDC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLHDC2