CREB3 Antibody (3H5)

Images

 
Western Blot: CREB3 Antibody (3H5) [H00010488-M01] - Analysis of CREB3 expression in transfected 293T cell line by CREB3 monoclonal antibody (M01), clone 3H5.Lane 1: CREB3 transfected lysate(41.4 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: CREB3 Antibody (3H5) [H00010488-M01] - Analysis of monoclonal antibody to CREB3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: CREB3 Antibody (3H5) [H00010488-M01] - Analysis of CREB3 over-expressed 293 cell line, cotransfected with CREB3 Validated Chimera RNAi ( Cat # H00010488-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Sandwich ELISA: CREB3 Antibody (3H5) [H00010488-M01] - Detection limit for recombinant GST tagged CREB3 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
3H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CREB3 Antibody (3H5) Summary

Immunogen
CREB3 (NP_006359, 273 a.a. ~ 372 a.a) partial recombinant protein with GST tag.DPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHY MPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWL PTGSPSVILQDRYSG
Specificity
CREB3 - cAMP responsive element binding protein 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CREB3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation, and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CREB3 Antibody (3H5)

  • basic leucine zipper protein
  • cAMP responsive element binding protein 3 (luman)
  • cAMP responsive element binding protein 3
  • cAMP-responsive element-binding protein 3
  • CREB-3
  • cyclic AMP response element (CRE)-binding protein/activating transcriptionfactor 1
  • cyclic AMP-responsive element-binding protein 3
  • LUMAN
  • LZIPMGC15333
  • MGC19782
  • Transcription factor LZIP-alpha

Background

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-1015
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-76539
Species: Hu, Mu
Applications: WB, ELISA, ICC
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB363
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-45970
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP1-82503
Species: Hu
Applications: WB, IHC, IHC-P
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-51927
Species: Hu
NBP2-58759
Species: Hu
Applications: ICC/IF
NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CREB3 Antibody (H00010488-M01) (0)

There are no publications for CREB3 Antibody (H00010488-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CREB3 Antibody (H00010488-M01) (0)

There are no reviews for CREB3 Antibody (H00010488-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CREB3 Antibody (H00010488-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CREB3 Products

Bioinformatics Tool for CREB3 Antibody (H00010488-M01)

Discover related pathways, diseases and genes to CREB3 Antibody (H00010488-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CREB3 Antibody (H00010488-M01)

Discover more about diseases related to CREB3 Antibody (H00010488-M01).
 

Pathways for CREB3 Antibody (H00010488-M01)

View related products by pathway.

PTMs for CREB3 Antibody (H00010488-M01)

Learn more about PTMs related to CREB3 Antibody (H00010488-M01).

Blogs on CREB3

There are no specific blogs for CREB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CREB3 Antibody (3H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CREB3
Entrez
OMIM
Uniprot