TEAD1 Antibody - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-95204] - Analysis of MCF7 cells using TEF1 .

Chromatin Immunoprecipitation: TEF1 Antibody [NBP2-95204] - Analysis of extracts of HeLa cells, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Immunoprecipitation: TEAD1 Antibody - Azide and BSA Free [TEAD1] - Immunoprecipitation of TEAD1 in 600 ug extracts from mouse heart using 3 ug TEAD1 Rabbit pAb . Western blot analysis was performed using TEAD1 Rabbit pAb at 1:200 dilution.

Western Blot: TEAD1 Antibody - Azide and BSA Free [TEAD1] - Western blot analysis of lysates from Rat lung using TEAD1 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time:90s.

Immunohistochemistry: TEAD1 Antibody - Azide and BSA Free [TEAD1] - Immunohistochemistry analysis of paraffin-embedded Human liver using TEAD1 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: TEAD1 Antibody - Azide and BSA Free [TEAD1] - Immunohistochemistry analysis of paraffin-embedded Human lung using TEAD1 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: TEAD1 Antibody - Azide and BSA Free [TEAD1] - Western blot analysis of various lysates using TEAD1 Rabbit pAb at 1:700 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 28s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TEAD1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit TEAD1 Antibody - Azide and BSA Free (NBP2-95204) is a polyclonal antibody validated for use in IHC, WB, ELISA, ICC/IF, IP and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 135-215 of human TEAD1 (NP_068780.2). AIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TEAD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 5μg antibody for 10μg-15μg of Chromatin
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 5μg-4μg antibody for 400μg-600μg extracts of whole cells
  • Western Blot 1:100 - 1:500
• Theoretical MW: 48 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TEAD1 Antibody - Azide and BSA Free

• AA
• NTEF-1
• Protein GT-IIC
• REF1
• TCF13
• TCF-13
• TEA domain family member 1 (SV40 transcriptional enhancer factor)
• TEAD1
• TEAD-1
• TEF1
• TEF-1
• transcription factor 13
• transcriptional enhancer factor 1
• transcriptional enhancer factor TEF-1

Background

This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TEAD1