KIN Antibody - BSA Free

Western Blot: KIN Antibody [NBP2-33374] - Human Spermatophore

Immunohistochemistry: KIN Antibody [NBP2-33374]

Western Blot: KIN Antibody [NBP2-33374] - WB Suggested Anti-KIN Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:2500. Positive Control: HepG2 cell lysateKIN is supported by BioGPS gene expression data to be expressed in HepG2

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

KIN Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KIN Antibody - BSA Free (NBP2-33374) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen for anti-KIN antibody: synthetic peptide directed towards the middle region of human KIN Peptide Sequence LKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDY The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for KIN Antibody - BSA Free

• antigenic determinant of recA protein (mouse) homolog
• Binding to curved DNA
• BTCDDNA/RNA-binding protein KIN17
• KIN, antigenic determinant of recA protein homolog (mouse)
• KIN, antigenic determinant of recA protein homolog
• KIN17antigenic determinant of recA protein homolog

Background

Kin is a nuclear protein that forms intranuclear foci during proliferation and is redistributed in the nucleoplasm during the cell cycle. Short-wave ultraviolet light provokes the relocalization of the protein, suggesting its participation in the cellular response to DNA damage. Originally selected based on protein-binding with RecA antibodies, the mouse protein presents a limited similarity with a functional domain of the bacterial RecA protein, a characteristic shared by the human ortholog.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KIN
• Uniprot:
  • O60870(Human)