TAP2 Antibody - Azide and BSA Free

Images

 
Western Blot: TAP2 Antibody [NBP2-93797] - Analysis of various lysates, using TAP2 antibody at 1:400 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. ...read more
Immunocytochemistry/ Immunofluorescence: TAP2 Antibody [NBP2-93797] - Analysis of NIH/3T3 cells using TAP2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: TAP2 Antibody [NBP2-93797] - Human colon carcinoma using TAP2 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before ...read more
Immunocytochemistry/ Immunofluorescence: TAP2 Antibody [NBP2-93797] - Analysis of C6 cells using TAP2 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

TAP2 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 450-686 of human TAP2 (NP_001276972.1). QPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAP2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:100 - 1:500

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for TAP2 Antibody - Azide and BSA Free

  • ABC18
  • ABCB3
  • ABCB3ABC18
  • antigen peptide transporter 2
  • APT2
  • ATP-binding cassette, sub-family B (MDR/TAP), member 3
  • D6S217E
  • MHC 2
  • Peptide transporter involved in antigen processing 2
  • Peptide transporter PSF2
  • Peptide transporter TAP2
  • PSF2
  • PSF2PSF-2
  • Really interesting new gene 11 protein
  • RING11
  • RING11ATP-binding cassette sub-family B member 3
  • TAP2
  • transporter 2, ABC (ATP binding cassette)
  • transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
  • Y1

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. This gene is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. This protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Alternative splicing of this gene produces two products which differ in peptide selectivity and level of restoration of surface expression of MHC class I molecules. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TAP2 Antibody (NBP2-93797) (0)

There are no publications for TAP2 Antibody (NBP2-93797).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAP2 Antibody (NBP2-93797) (0)

There are no reviews for TAP2 Antibody (NBP2-93797). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAP2 Antibody (NBP2-93797) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAP2 Products

Research Areas for TAP2 Antibody (NBP2-93797)

Find related products by research area.

Blogs on TAP2

There are no specific blogs for TAP2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAP2 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TAP2