KGF/FGF-7 Antibody (4L2O8) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KGF/FGF-7 (NP_002000.1). MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEI |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
FGF7 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 -1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for KGF/FGF-7 Antibody (4L2O8)
Background
Keratinocyte Growth Factor (KGF, FGF-7, HBGF-7) is a member of the FGF family of 23 related mitogenic proteins. These proteins play a central role during embryonic development and postnatal growth and tissue repair, by promoting cellular proliferation and differentiation. KGF specifically stimulates epithelial cells and keratinocytes, it is the most potent growth factor identified thus far for skin keratinocytes. KGF takes part in the development of kidney and lung, angiogenesis and has a key role in wound healing following skin injuries. It shows considerable species cross-reactivity (mouse, monkey, porcine cells) as the other members of the FGF family.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, Neut, Simple Western, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Publications for KGF/FGF-7 Antibody (NBP3-16623) (0)
There are no publications for KGF/FGF-7 Antibody (NBP3-16623).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KGF/FGF-7 Antibody (NBP3-16623) (0)
There are no reviews for KGF/FGF-7 Antibody (NBP3-16623).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KGF/FGF-7 Antibody (NBP3-16623) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KGF/FGF-7 Products
Research Areas for KGF/FGF-7 Antibody (NBP3-16623)
Find related products by research area.
|
Blogs on KGF/FGF-7