KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free (NBP2-68975) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY |
| Predicted Species |
Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GRIK5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free
Background
Glutamate receptor KA2 is a protein that interacts with glutamate, an excitatory neurotransmitter, in the central nervous system and that has two isoforms, measuring 980 and 981 amino acids in length, with weights of approximately 109 and 110 kDa respectively. Current studies are being done on diseases and disorders related to this protein including temporal lobe epilepsy, embryonal carcinoma, Parkinson's disease, schizophrenia, retinoblastoma, neruoblastoma, thyroiditis, and neuronitis. Glutamate receptor KA2 has also been shown to have interactions with GOLM1, GPAA1, LRSAM1, DLG4, and GRID2 in pathways such as the glutamic acid signaling, transmission across chemical synapses, and activation of kainite receptor pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu
Applications: ICC, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IP, Simple Western, WB
Publications for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP2-68975) (0)
There are no publications for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP2-68975).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP2-68975) (0)
There are no reviews for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP2-68975).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP2-68975) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KA2/GRIK5/Glutamate Receptor KA2 Products
Research Areas for KA2/GRIK5/Glutamate Receptor KA2 Antibody (NBP2-68975)
Find related products by research area.
|
Blogs on KA2/GRIK5/Glutamate Receptor KA2