JAM-C Antibody - BSA Free

Western Blot: JAM-C Antibody [NBP1-92032] - Analysis in human cell line BEWO.

Immunocytochemistry/Immunofluorescence: JAM-C Antibody [NBP1-92032] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: JAM-C Antibody [NBP1-92032] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: JAM-C Antibody [NBP1-92032] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.

Immunohistochemistry-Paraffin: JAM-C Antibody [NBP1-92032] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: JAM-C Antibody [NBP1-92032] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

JAM-C Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JAM3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  JAM-C Protein (NBP1-92032PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for JAM-C Antibody - BSA Free

• CD323
• JAM-2
• JAM3
• JAMC
• JAM-C
• JAM-CFLJ14529
• junctional adhesion molecule 3JAM-3
• junctional adhesion molecule C

Background

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for JAM-C Antibody (NBP1-92032)(2)

Publications using NBP1-92032

• N McMillan, GW Kirschen, S Desai, E Xia, SE Tsirka, A Aguirre ADAM10 facilitates rapid neural stem cell cycling and proper positioning within the subventricular zone niche via JAMC/RAP1Gap signaling Neural regeneration research, 2022-11-01;17(11):2472-2483. 2022-11-01 [PMID: 35535899]
• Asplund A, Gry Bjorklund M, Sundquist C et al. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. Br J Dermatol 2008-03-01 [PMID: 18241271]

Bioinformatics

• Gene Symbol: JAM3