We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Claudin-5 Antibody - Azide and BSA Free

Images

 
Western Blot: Claudin-5 Antibody [NBP2-92846] -analysis of various lysates, using CLDN5 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per ...read more
Immunocytochemistry/ Immunofluorescence: Claudin-5 Antibody [NBP2-92846] - Analysis of U2OS cells using Claudin-5 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Claudin-5 Antibody - Azide and BSA Free [NBP2-92846] - Immunofluorescence analysis of NIH/3T3 cells using Claudin-5 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat ...read more
Analysis of paraffin-embedded Rat lung tissue using CLDN5 Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Analysis of paraffin-embedded Mouse brain tissue using CLDN5 Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Analysis of paraffin-embedded Rat spleen tissue using CLDN5 Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Claudin-5 Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 119-218 of human Claudin-5 (NP_001349995.1). LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLDN5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:1000 - 1:4000
  • Immunohistochemistry-Paraffin 1:1000 - 1:4000
  • Western Blot 1:1000 - 1:5000
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Claudin-5 Antibody - Azide and BSA Free

  • AWAL
  • AWALTransmembrane protein deleted in VCFS
  • BEC1
  • claudin 5
  • Claudin5
  • Claudin-5
  • CLDN5
  • CPETRL1
  • TMDVCF
  • TMVCF1
  • TMVCFTMDVCF
  • transmembrane protein deleted in velocardiofacial syndrome

Background

The Claudin superfamily consists of many structurally related proteins in humans. These proteins are important structural and functional components of tight junctions in paracellular transport. Claudins are located in both epithelial and endothelial cells in all tight junction-bearing tissues. Three classes of proteins are known to localize to tight junctions, including the Claudins, Occludin and junction adhesion molecule (JAM). Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. Claudin expression is highly restricted to specific regions of different tissues and may have an important role in transcellular transport through tight junctions. Claudin-5 is expressed in the endothelial junctions of the rat liver and in junctions of acinar cells of the pancreas. Human claudin-5 is abundantly expressed in adult lung, heart and skeletal muscle and is deleted in patients with velocardiofacial syndrome, which is characterized by cleft palate, facial dysmorphology and conotruncal heart defects.The human claudin-5 gene maps to chromosome 22q11.21.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87402
Species: Hu
Applications: IHC,  IHC-P, KD, WB
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-87402
Species: Hu
Applications: IHC,  IHC-P, KD, WB
H00001366-P01
Species: Hu
Applications: ELISA, EnzAct, AP, PA, WB
NBP3-18555
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-41187
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-92140
Species: Hu, Mu, Rt
Applications: ELISA, WB
AF1002
Species: Mu
Applications: Dual ISH-IHC, IHC, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
DMP900
Species: Hu
Applications: ELISA
NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, Simple Western, WB
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB

Publications for Claudin-5 Antibody (NBP2-92846) (0)

There are no publications for Claudin-5 Antibody (NBP2-92846).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Claudin-5 Antibody (NBP2-92846) (0)

There are no reviews for Claudin-5 Antibody (NBP2-92846). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Claudin-5 Antibody (NBP2-92846) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Claudin-5 Products

Research Areas for Claudin-5 Antibody (NBP2-92846)

Find related products by research area.

Blogs on Claudin-5

There are no specific blogs for Claudin-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Claudin-5 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN5