PARD3/Par3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line U-2 OS shows localization to cell junctions.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human colon shows distinct luminal membranous positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining PARD3 in mouse trophoblast stem cells. Verified customer review from 1DegreeBio.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line 8505C cells (anaplastic thyroid cancer cell line). Image from verified customer review.
Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Simple Western lane view shows a specific band for PARD3/Par3 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa ...read more
Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Electropherogram image(s) of corresponding Simple Western lane view. PARD3/Par3 antibody was used at 1:100 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARD3/Par3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Simple Western 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
PARD3/Par3 Protein (NBP1-88861PEP)
Reviewed Applications
Read 2 Reviews rated 4
using
NBP1-88861 in the following applications:

Publications
Read Publications using
NBP1-88861 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARD3/Par3 Antibody

  • ASIP
  • Baz
  • Bazooka
  • FLJ21015
  • par-3 partitioning defective 3 homolog (C. elegans)
  • PAR3
  • PAR3A
  • PAR3C.elegans) homolog
  • PARD3
  • SE2-5L16
  • SE2-5LT1
  • SE2-5T2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC
NBP2-38487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49382
Species: Hu
Applications: IHC
H00009002-M01
Species: Hu
Applications: WB, ELISA
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-87338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
MAB3949
Species: Hu
Applications: Flow, CyTOF-ready
NB500-178
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ICC/IF
19540002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP1-88861
Species: Hu, Mu
Applications: Simple Western, ICC/IF, IHC, IHC-P

Publications for PARD3/Par3 Antibody (NBP1-88861)(3)

Reviews for PARD3/Par3 Antibody (NBP1-88861) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.
We have 2 reviews tested in 2 application: IF, ICC.

Reviews using NBP1-88861:
Filter by Applications
IF
(1)
ICC
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence PARD3/Par3 NBP1-88861
Enlarge
reviewed by:
enke baldini
IF Human 04/29/2014
View

Summary

ApplicationImmunofluorescence
Sample Testedcell line derived from anaplastic thyroic cancer
SpeciesHuman
LotA57864
CommentsThe secondary antibody TRITC-conjugated Donkey anti-Mouse IgG was used for detecting the primary antibody anti-beta tubulin.

Blocking

Blocking DetailsPBS with bovine serum albumin 3% for 1 h at r.t.

Primary Anitbody

Dilution Ratiodilution 1:150 in PBS with bovine serum albumin 1.5%; incubation for 2 h at r.t.

Secondary Antibody

Secondary DescriptionFITC-conjugated Donkey anti-Rabbit IgG
Secondary Manufacturer Cat#711-095-152 Jackson ImmunoResearch Laboratories
Secondary Concentration7.5 ug/ml

Details

Fixation Detailsfixation for 10 min in cold methanol
Wash Description4-5 washes in PBS with bovine serum albumin 1.5%

Comments

CommentsThe secondary antibody TRITC-conjugated Donkey anti-Mouse IgG was used for detecting the primary antibody anti-beta tubulin.
Immunocytochemistry PARD3/Par3 NBP1-88861
Enlarge
reviewed by:
Andrew Cosgrove
ICC Mouse 11/07/2013
View

Summary

ApplicationImmunocytochemistry
Sample TestedMouse trophoblast stem cells
SpeciesMouse
CommentsPhalloidin conjugated with Alexa 488 was used for counterstaining. A confocal microscope was used for scanning of the sample and accumulation of Pard3 in the tight junctions was observed.

Blocking

Blocking Details2%BSA in PBS-T

Primary Anitbody

Dilution Ratio1:250

Secondary Antibody

Secondary Descriptiondonkey anti-rabbit IgG conjugated with CF647
Secondary Manufacturer Cat#Biotium - 20047
Secondary Concentration1:1000

Details

Fixation DetailsFixed in 4% PFA/PBS

Comments

CommentsPhalloidin conjugated with Alexa 488 was used for counterstaining. A confocal microscope was used for scanning of the sample and accumulation of Pard3 in the tight junctions was observed.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PARD3/Par3 Antibody (NBP1-88861) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARD3/Par3 Products

Bioinformatics Tool for PARD3/Par3 Antibody (NBP1-88861)

Discover related pathways, diseases and genes to PARD3/Par3 Antibody (NBP1-88861). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARD3/Par3 Antibody (NBP1-88861)

Discover more about diseases related to PARD3/Par3 Antibody (NBP1-88861).
 

Pathways for PARD3/Par3 Antibody (NBP1-88861)

View related products by pathway.

PTMs for PARD3/Par3 Antibody (NBP1-88861)

Learn more about PTMs related to PARD3/Par3 Antibody (NBP1-88861).
 

Research Areas for PARD3/Par3 Antibody (NBP1-88861)

Find related products by research area.

Blogs on PARD3/Par3

There are no specific blogs for PARD3/Par3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

enke baldini
04/29/2014
Application: IF
Species: Human

Andrew Cosgrove
11/07/2013
Application: ICC
Species: Mouse

Bioinformatics

Gene Symbol PARD3
Entrez