Orthogonal Strategies: Western Blot: PARD3/Par3 Antibody [NBP1-88861] - Analysis in human cell lines A-549 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Simple Western lane view shows a specific band for PARD3/Par3 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa ...read more
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining PARD3 in mouse trophoblast stem cells. Verified customer review from 1DegreeBio.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human colon shows distinct luminal membranous positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. In wild-type myotubes PAR3 remains cytoplasmic. MCAM contributes to the establishment ...read more
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human skin shows weak to moderate cytoplasmic positivity in epidermal cells.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line 8505C cells (anaplastic thyroid cancer cell line). Image from verified customer review.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human kidney shows weak to moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cerebellum shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human fallopian tube shows weak to moderate positivity in luminal membrane in glandular cells.
Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Electropherogram image(s) of corresponding Simple Western lane view. PARD3/Par3 antibody was used at 1:100 dilution on RT-4 lysate(s).
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. (A) In elongating myotubes (10T1/2 cells treated with testosterone for 7 days) VANGL2 ...read more
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. (A) In elongating myotubes (10T1/2 cells treated with testosterone for 7 days) VANGL2 ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunoprecipitation Reported in scientific literature (PMID:34158849).
Simple Western 1:100
Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:100, apparent MW was 190 kDa
PARD3 is an adaptor protein involved in asymmetrical cell division and cell polarization processes. PARD3 seems to play a central role in the formation of epithelial tight junctions. PARD3 may affect the quality of hair pigmentation, and act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone (2-3). PARD3 may also play a role in neuroendocrine aspects of melanocortin action, and have a functional role in regulating lipid metabolism in adipocytes (4-5). Recent studies have suggested PARD3 (Par-3) is essential in the formation of myelin sheaths on neuronal axons.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.