PARD3/Par3 Antibody

Images

 
Orthogonal Strategies: Western Blot: PARD3/Par3 Antibody [NBP1-88861] - Analysis in human cell lines A-549 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more
Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Simple Western lane view shows a specific band for PARD3/Par3 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa ...read more
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining PARD3 in mouse trophoblast stem cells. Verified customer review from 1DegreeBio.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human colon shows distinct luminal membranous positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - MCAM is required to establish cell autonomous polarity. In wild-type myotubes PAR3 remains cytoplasmic. MCAM contributes to the establishment ...read more
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human skin shows weak to moderate cytoplasmic positivity in epidermal cells.
Immunocytochemistry/ Immunofluorescence: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cell line 8505C cells (anaplastic thyroid cancer cell line). Image from verified customer review.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human kidney shows weak to moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human cerebellum shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: PARD3/Par3 Antibody [NBP1-88861] - Staining of human fallopian tube shows weak to moderate positivity in luminal membrane in glandular cells.
Simple Western: PARD3/Par3 Antibody [NBP1-88861] - Electropherogram image(s) of corresponding Simple Western lane view. PARD3/Par3 antibody was used at 1:100 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PARD3/Par3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Immunoprecipitation
  • Simple Western 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Use in IP reported in scientific literature (PMID:34158849). ICC/IF reported in scientific literature (PMID:28923978). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. PARD3/Par3 antibody validated for ICC/IF from verified customer reviews.
Control Peptide
PARD3/Par3 Recombinant Protein Antigen (NBP1-88861PEP)
Reviewed Applications
Read 2 Reviews rated 4
using
NBP1-88861 in the following applications:

Publications
Read Publications using
NBP1-88861 in the following applications:

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARD3/Par3 Antibody

  • ASIP
  • Baz
  • Bazooka
  • FLJ21015
  • par-3 partitioning defective 3 homolog (C. elegans)
  • PAR3
  • PAR3A
  • PAR3C.elegans) homolog
  • PARD3
  • SE2-5L16
  • SE2-5LT1
  • SE2-5T2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP2-38487
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81746
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
NBP2-49382
Species: Hu
Applications: IHC, IHC-P
NLS1040
Species: Hu, Pm
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-87338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-53125
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB3949
Species: Hu
Applications: CyTOF-ready, Flow
NB500-178
Species: Ch, Hu, Mu
Applications: ICC/IF, Simple Western, WB
DAGR00
Species: Hu
Applications: ELISA
H00055065-P01
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for PARD3/Par3 Antibody (NBP1-88861)(8)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 5 applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP.


Filter By Application
ICC/IF
(3)
IHC
(2)
IHC-Fr
(1)
IHC-P
(1)
IP
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(4)
All Species
Showing Publications 1 - 8 of 8.
Publications using NBP1-88861 Applications Species
Das A, Adhikary S, Roy Chowdhury A, Barui A Leveraging substrate stiffness to promote stem cell asymmetric division via mechanotransduction-polarity protein axis and its Bayesian regression analysis Rejuvenation research Mar 22 2022 [PMID: 35316074] (ICC/IF) ICC/IF
Heinrich A, Bhandary B, Potter SJ Et al. Cdc42 activity in Sertoli cells is essential for maintenance of spermatogenesis Cell reports Oct 26 2021 [PMID: 34706238] (IHC-Fr, Mouse) IHC-Fr Mouse
Zhou Y, Ji H, Xu Q et al. Congenital biliary atresia is correlated with disrupted cell junctions and polarity caused by Cdc42 insufficiency in the liver Theranostics May 24 2021 [PMID: 34158849] (IP, Mouse) IP Mouse
Engevik AC, Krystofiak ES, Kaji I et al. Recruitment of Polarity Complexes and Tight Junction Proteins to the Site of Apical Bulk Endocytosis Cellular and molecular gastroenterology and hepatology Feb 3 2021 [PMID: 33548596] (IHC-P, Mouse) IHC-P Mouse
Heinrich A, Potter SJ, Guo L et al. Distinct Roles for Rac1 in Sertoli Cell Function during Testicular Development and Spermatogenesis Cell Rep Apr 14 2020 [PMID: 32294451] (IHC, Human) IHC Human
Moreno-Fortuny A, Bragg L, Cossu G, Roostalu U. MCAM contributes to the establishment of cell autonomous polarity in myogenic and chondrogenic differentiation. Biol Open. 2017 Sep 18 [PMID: 28923978] (ICC/IF) ICC/IF
Tuccilli C, Baldini E, Arlot-Bonnemains Y et al. Expression and prognostic value of the cell polarity PAR complex members in thyroid cancer. Int J Oncol 2017 Mar 08 [PMID: 28350047]
Whiteman EL, Fan S, Harder JL et al. Crumbs3 is Essential for Proper Epithelial Development and Viability. Mol Cell Biol. 2013 Oct 28 [PMID: 24164893] (IHC, ICC/IF, Mouse) IHC, ICC/IF Mouse

Reviews for PARD3/Par3 Antibody (NBP1-88861) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-88861:
Filter by Applications
IF
(1)
ICC
(1)
All Applications
Filter by Species
Human
(1)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence PARD3/Par3 NBP1-88861
Enlarge
4
reviewed by:
Verified Customer
IF Human 04/29/2014
View

Summary

ApplicationImmunofluorescence
Sample Testedcell line derived from anaplastic thyroic cancer
SpeciesHuman
LotA57864
Immunocytochemistry PARD3/Par3 NBP1-88861
Enlarge
4
reviewed by:
Verified Customer
ICC Mouse 11/07/2013
View

Summary

ApplicationImmunocytochemistry
Sample TestedMouse trophoblast stem cells
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PARD3/Par3 Antibody (NBP1-88861) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARD3/Par3 Products

Bioinformatics Tool for PARD3/Par3 Antibody (NBP1-88861)

Discover related pathways, diseases and genes to PARD3/Par3 Antibody (NBP1-88861). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARD3/Par3 Antibody (NBP1-88861)

Discover more about diseases related to PARD3/Par3 Antibody (NBP1-88861).
 

Pathways for PARD3/Par3 Antibody (NBP1-88861)

View related products by pathway.

PTMs for PARD3/Par3 Antibody (NBP1-88861)

Learn more about PTMs related to PARD3/Par3 Antibody (NBP1-88861).
 

Research Areas for PARD3/Par3 Antibody (NBP1-88861)

Find related products by research area.

Blogs on PARD3/Par3

There are no specific blogs for PARD3/Par3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

Verified Customer
04/29/2014
Application: IF
Species: Human

Verified Customer
11/07/2013
Application: ICC
Species: Mouse

Bioinformatics

Gene Symbol PARD3